Pioneer PD-50AE de handleiding

Merk: Pioneer

Model: PD-50AE

Categorie: Dvd spelers

Type: de handleiding

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

SUPER AUDIO CD PLAYER

PD-50AE

Instruction

Manual

Before Start

Safety Information .................................................................. 2

What's in the box .................................................................... 3

Part Names

Front Panel ............................................................................. 4

Rear Panel .............................................................................. 5

Remote Controller .................................................................. 6

Display .................................................................................... 7

Install

Connections with an amplifier ................................................. 8

Connecting the power cord, etc. ............................................11

Playback

Playing discs ......................................................................... 12

Using this unit as a D/A converter ........................................ 14

Adjusting sound quality ......................................................... 15

Advanced Setup

Advanced Settings................................................................. 16

Others

Troubleshooting .................................................................... 17

Other notes............................................................................ 18

General Specifications........................................................... 19

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Safety Information

Before Start

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

7KHOLJKWQLQJIODVKZLWKDUURZKHDGV\PEROZLWKLQDQ

HTXLODWHUDOWULDQJOHLVLQWHQGHGWRDOHUWWKHXVHUWRWKH

SUHVHQFHRIXQLQVXODWHG³GDQJHURXVYROWDJH´ZLWKLQWKH

SURGXFW¶VHQFORVXUHWKDWPD\EHRIVXႈFLHQWPDJQLWXGHWR

FRQVWLWXWHDULVNRIHOHFWULFVKRFNWRSHUVRQV

7KHH[FODPDWLRQSRLQWZLWKLQDQHTXLODWHUDOWULDQJOHLV

LQWHQGHGWRDOHUWWKHXVHUWRWKHSUHVHQFHRILPSRUWDQW

RSHUDWLQJDQGPDLQWHQDQFHVHUYLFLQJLQVWUXFWLRQVLQWKH

OLWHUDWXUHDFFRPSDQ\LQJWKHDSSOLDQFH

&$87,21

7235(9(177+(5,6.2)(/(&75,&6+2&.'21275(029(

&29(525%$&.1286(56(59,&($%/(3$576,16,'(

5()(56(59,&,1*7248$/,),('6(59,&(3(56211(/

:$51,1*

7235(9(177+(5,6.2)(/(&75,&6+2&.'21275(029(

&29(525%$&.1286(56(59,&($%/(3$576,16,'(

5()(56(59,&,1*7248$/,),('6(59,&(3(56211(/

7KLVHTXLSPHQWLVQRWZDWHUSURRI7RSUHYHQWD¿UHRUVKRFNKD]DUGGR

QRWSODFHDQ\FRQWDLQHU¿OOHGZLWKOLTXLGQHDUWKLVHTXLSPHQWVXFKDVD

YDVHRUÀRZHUSRWRUH[SRVHLWWRGULSSLQJVSODVKLQJUDLQRUPRLVWXUH

7RSUHYHQWD¿UHKD]DUGGRQRWSODFHDQ\QDNHGÀDPHVRXUFHVVXFK

DVDOLJKWHGFDQGOHRQWKHHTXLSPHQW

'RQRWXVHRUVWRUHEDWWHULHVLQGLUHFWVXQOLJKWRURWKHUH[FHVVLYHO\KRW

SODFHVXFKDVLQVLGHDFDURUQHDUDKHDWHU7KLVFDQFDXVHEDWWHULHV

WROHDNRYHUKHDWH[SORGHRUFDWFK¿UH,WFDQDOVRUHGXFHWKHOLIHRU

SHUIRUPDQFHRIEDWWHULHV

6WRUHVPDOOSDUWVRXWRIWKHUHDFKRIFKLOGUHQDQGLQIDQWV,IDFFLGHQWDOO\

VZDOORZHGFRQWDFWDGRFWRULPPHGLDWHO\

6ORWVDQGRSHQLQJVLQWKHFDELQHWDUHSURYLGHGIRUYHQWLODWLRQWRHQVXUH

UHOLDEOHRSHUDWLRQRIWKHSURGXFWDQGWRSURWHFWLWIURPRYHUKHDWLQJ7R

SUHYHQW¿UHKD]DUGWKHRSHQLQJVVKRXOGQHYHUEHEORFNHGRUFRYHUHG

ZLWKLWHPVVXFKDVQHZVSDSHUVWDEOHFORWKVFXUWDLQVRUE\RSHUDWLQJ

WKHHTXLSPHQWRQWKLFNFDUSHWRUDEHG

5LVNRIH[SORVLRQLIEDWWHU\LVUHSODFHGE\DQLQFRUUHFWW\SH5LVNRI

H[SORVLRQ,IGLVSRVDORIDEDWWHU\LQWR¿UHRUDKRWRYHQRUPHFKDQLFDOO\

FUXVKLQJRUFXWWLQJRIDEDWWHU\

3UHFDXWLRQV

,I\RXLQVWDOOWKHDSSDUDWXVLQDEXLOWLQLQVWDOODWLRQVXFKDVDERRNFDVH

RUUDFNHQVXUHWKDWWKHUHLVDGHTXDWHYHQWLODWLRQ

/HDYHFP´RIIUHHVSDFHDWWKHWRSDQGVLGHVDQGFP´DW

WKHUHDU7KHUHDUHGJHRIWKHVKHOIRUERDUGDERYHWKHDSSDUDWXVVKDOO

EHVHWFP´DZD\IURPWKHUHDUSDQHORUZDOOFUHDWLQJDÀXHOLNH

JDSIRUZDUPDLUWRHVFDSH

2SHUDWLQJ(QYLURQPHQW

2SHUDWLQJHQYLURQPHQWWHPSHUDWXUHDQGKXPLGLW\&WR&

)WR)OHVVWKDQ5+FRROLQJYHQWVQRWEORFNHG

'RQRWLQVWDOOWKLVXQLWLQDSRRUO\YHQWLODWHGDUHDRULQORFDWLRQVH[SRVHG

WRKLJKKXPLGLW\RUGLUHFWVXQOLJKWRUVWURQJDUWL¿FLDOOLJKW

,PSRUWDQW1RWLFH

7KHPRGHOQXPEHUDQGVHULDOQXPEHURIWKLVHTXLSPHQWDUHRQWKHUHDU

RUERWWRP5HFRUGWKHVHQXPEHUVRQ\RXUHQFORVHGZDUUDQW\FDUGDQG

NHHSLQDVDIHSODFHIRUIXWXUHUHIHUHQFH

&$87,21

7KHSRZHUVZLWFKEXWWRQRQWKLVXQLWZLOOQRWFRPSOHWHO\VKXWRIIDOO

SRZHUIURPWKH$&RXWOHW6LQFHWKHSRZHUFRUGVHUYHVDVWKHPDLQ

GLVFRQQHFWGHYLFHIRUWKHXQLW\RXZLOOQHHGWRXQSOXJLWIURPWKH$&

RXWOHWWRVKXWGRZQDOOSRZHU7KHUHIRUHPDNHVXUHWKHXQLWKDVEHHQ

LQVWDOOHGVRWKDWWKHSRZHUFRUGFDQEHHDVLO\XQSOXJJHGIURPWKH

$&RXWOHWLQFDVHRIDQDFFLGHQW7RDYRLG¿UHKD]DUGWKHSRZHUFRUG

VKRXOGDOVREHXQSOXJJHGIURPWKH$&RXWOHWZKHQOHIWXQXVHGIRUD

ORQJSHULRGRIWLPHIRUH[DPSOHZKHQRQYDFDWLRQ

7KLVSURGXFWLVIRUJHQHUDOKRXVHKROGSXUSRVHV$Q\IDLOXUHGXHWRXVH

IRURWKHUWKDQKRXVHKROGSXUSRVHVVXFKDVORQJWHUPXVHIRUEXVLQHVV

SXUSRVHVLQDUHVWDXUDQWRUXVHLQDFDURUVKLSDQGZKLFKUHTXLUHV

UHSDLUZLOOEHFKDUJHGIRUHYHQGXULQJWKHZDUUDQW\SHULRG

3RZHU&RUG&DXWLRQ

+DQGOHWKHSRZHUFRUGE\WKHSOXJ'RQRWSXOORXWWKHSOXJE\WXJJLQJ

WKHFRUGDQGQHYHUWRXFKWKHSRZHUFRUGZKHQ\RXUKDQGVDUHZHW

DVWKLVFRXOGFDXVHDVKRUWFLUFXLWRUHOHFWULFVKRFN'RQRWSODFHWKH

XQLWDSLHFHRIIXUQLWXUHHWFRQWKHSRZHUFRUGRUSLQFKWKHFRUG

1HYHUPDNHDNQRWLQWKHFRUGRUWLHLWZLWKRWKHUFRUGV7KHSRZHU

FRUGVVKRXOGEHURXWHGVXFKWKDWWKH\DUHQRWOLNHO\WREHVWHSSHGRQ$

GDPDJHGSRZHUFRUGFDQFDXVHD¿UHRUJLYH\RXDQHOHFWULFDOVKRFN

&KHFNWKHSRZHUFRUGRQFHLQDZKLOH:KHQ\RXILQGLWGDPDJHG

DVN\RXUQHDUHVWRXUDXWKRUL]HGVHUYLFHFHQWHURU\RXUGHDOHUIRUD

UHSODFHPHQW

&$87,21

7KLVSURGXFWLVDFODVVODVHUSURGXFWFODVVL¿HGXQGHUWKH6DIHW\RI

ODVHUSURGXFWV,(&

CLASS 1 LASER PRODUCT

,QIRUPDWLRQIRUXVHUVRQFROOHFWLRQDQGGLVSRVDO

RIROGHTXLSPHQWDQGXVHGEDWWHULHV

Symbol for

equipment

Symbol examples

for batteries

7KHVHV\PEROVRQWKHSURGXFWVSDFNDJLQJDQGRUDFFRPSDQ\LQJ

GRFXPHQWVPHDQWKDWXVHGHOHFWULFDODQGHOHFWURQLFSURGXFWVDQG

EDWWHULHVVKRXOGQRWEHPL[HGZLWKJHQHUDOKRXVHKROGZDVWH

)RUSURSHUWUHDWPHQWUHFRYHU\DQGUHF\FOLQJRIROGSURGXFWVDQG

XVHGEDWWHULHVSOHDVHWDNHWKHPWRDSSOLFDEOHFROOHFWLRQSRLQWVLQ

DFFRUGDQFHZLWK\RXUQDWLRQDOOHJLVODWLRQ

%\GLVSRVLQJRIWKHVHSURGXFWVDQGEDWWHULHVFRUUHFWO\\RXZLOOKHOS

WRVDYHYDOXDEOHUHVRXUFHVDQGSUHYHQWDQ\SRWHQWLDOQHJDWLYH

HႇHFWVRQKXPDQKHDOWKDQGWKHHQYLURQPHQWZKLFKFRXOG

RWKHUZLVHDULVHIURPLQDSSURSULDWHZDVWHKDQGOLQJ

)RUPRUHLQIRUPDWLRQDERXWFROOHFWLRQDQGUHF\FOLQJRIROGSURGXFWV

DQGEDWWHULHVSOHDVHFRQWDFW\RXUORFDOPXQLFLSDOLW\\RXUZDVWH

GLVSRVDOVHUYLFHRUWKHSRLQWRIVDOHZKHUH\RXSXUFKDVHGWKH

LWHPV

7KHVHV\PEROVDUHRQO\YDOLGLQWKH(XURSHDQ8QLRQ

)RUFRXQWULHVRXWVLGHWKH(XURSHDQ8QLRQ

,I\RXZLVKWRGLVFDUGWKHVHLWHPVSOHDVHFRQWDFW\RXUORFDO

DXWKRULWLHVRUGHDOHUDQGDVNIRUWKHFRUUHFWPHWKRGRIGLVSRVDO

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

What's in the box

1. Main unit (1)

2. Remote controller (RC-980C) (1), Batteries (AAA/R03) (2)

3. Analog Audio Cable (For testing operation) (1)

4. Power Cord (1)

• Instruction Manual (This document) (1)

• The power cord must be connected only after all other cable connections are completed.

• We will not accept responsibility for damage arising from the connection of equipment

manufactured by other companies.

• Specifications and appearance are subject to change without prior notice.

The main power cannot be turned on or off with the remote controller. Use the 8 STANDBY/

ON button on the main unit.

> Before Start >Part Names > Install > Playback

Advanced Setup | Others

Front Panel

Part Names

1. 8 STANDBY/ON button/indicator: Switch the main power of the unit on and off. When

starting up the unit, the indicator in the center of the button lights blue.

2. STANDBY indicator: Lights red when the unit is in standby mode.

3. Disc tray: Place discs here. 8-cm discs can also be used.

4. ; button: Open or close the disc tray.

5. Play buttons:

u t : Return to the beginning of the track being played. Press again to move to the

track before. Press and hold to rewind the track quickly.

/h : Play or pause play.

y i : When pressed during play, move to the next track. Press and hold to fast-

forward through the track.

: This button stops playback.

6. Remote control sensor

• The reception range of the remote controller is within a distance of approx. 16´/5 m,

and an angle of 20° in vertical direction and 30° to right and left.

7. CD/SACD button/indicator: Switch between CD/SACD as the source. When playing a

hybrid SACD, the layer being played switches if you press this during play. (P18)

The indicator lights blue when SACD is selected.

8. DIRECT button/indicator: Switch the DIRECT mode ON and OFF. (P15)

The indicator lights blue when the DIRECT mode is ON.

9. Display (P7)

10.

SOURCE button: Switches the source to be played.

11.

SETUP button: Displays the SETUP menu. (P16)

6bkbl87 9

14352

> Before Start >Part Names > Install > Playback

Advanced Setup | Others

Rear Panel

1. ANALOG OUT jack: Use an analog audio cable to connect an integrated amplifier, for

example.

2. AC IN: Connect the supplied power cord.

3. USB DAC port: Use a USB cable (A-B type) to connect a computer.

4. DIGITAL OUT OPTICAL/COAXIAL jack: Use a digital optical cable or digital coaxial cable

to connect an integrated amplifier, for example.

5. CONTROL IN/OUT jack: By connecting Pioneer brand amplifiers and audio devices,

centralized control is possible, for example you can control the amplifiers and audio

devices.

345

> Before Start >Part Names > Install > Playback

Advanced Setup | Others

Remote Controller

1. ^ STANDBY/ON button: When the main power of the unit

is on, this turns the unit on or into standby mode. The

main power cannot be turned on or off with the remote

controller.

2. SHUFFLE button: Set shuffle play. (P13)

3. REPEAT button: Set repeat play. (P13)

4. Numbered buttons: Use to directly input the track number

of a music CD when selecting tracks. Also used to enter

track numbers for program play.

5. CLEAR button: Clear the content set for program play.

(P13)

6. DIGITAL FILTER button: Select one of three types of

DIGITAL FILTER. (P15)

7. Cursors, ENTER button: Select the item with the cursors

and press ENTER to confirm.

8. SETUP button: Displays the SETUP menu. (P16)

9. Play buttons:

u : Return to the beginning of the track being played.

Press again to move to the track before.

/h : Play or pause play.

i : Move to the next track.

t : Press and hold to fast-rewind through the track

being played.

g : Stop playback.

y : Press and hold to fast-forward through the track

being played.

10.

SOURCE button: Switches the source to be played.

11.

DIRECT button: Switch the DIRECT mode on and off.

(P15)

12.

DISPLAY button: Switch the information on the display.

• Depending on the source, the operation may not start.

13.

; OPEN/CLOSE button: Open or close the disc tray.

14.

PROGRAM button: Used for program play. (P13)

15.

LOCK RANGE button: Displays the LOCK RANGE

ADJUST settings screen. (P15)

16.

RETURN button: Returns the display to the previous

state.

17.

UP SAMPLING button: Switch the UP SAMPLING

feature ON and OFF. (P15)

18.

CD/SACD button: Switch between CD/SACD as the

source. When playing a hybrid SACD, the layer being

played switches if you press this during play. (P18)

19.

DIGITAL OUT button: Switch the digital output ON and

OFF. (P16)

20.

DISPLAY OFF button: Press to turn off the display of this

unit. Press again to turn the display on.

21.

DIMMER button: You can adjust the brightness of the

display in three steps. (Default Value: Level 3)

bl bt

bm ck

Match the polarity when

inserting the batteries.

> Before Start >Part Names > Install > Playback

Advanced Setup | Others

Display

1. Lights during play of SACD and DSD.

2. Message display: Displays information about tracks and menus.

3. Lights when operations with the cursor buttons on the remote controller are possible.

4. Displays the play status.

5. Lights when the digital audio output setting is on. (P16)

6. Lights when showing such items as the remaining time for a track or the disc, or the total

time of the disc.

7. Display when an MQA file or stream is played. For details, refer to "Playing MQA".

(P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Before Start > Part Names >Install > Playback

Advanced Setup | Others

Connections with an amplifier

Install

Play the audio from discs played on this unit and from

devices connected to this unit through speaker systems

connected to integrated amplifiers or AV receivers. Connect

to suit the input jacks on your amplifier.

Connecting with an analog audio cable

The signal is converted to analog in the D/A converter of

this unit and then output to an integrated amplifier, for

example. Connect the LINE IN jacks on an integrated

amplifier to the ANALOG OUT jack (RCA jack) on this unit.

This unit

Integrated amplifier, AV receiver, etc.

a Analog Audio Cable

> Before Start > Part Names >Install > Playback

Advanced Setup | Others

Connecting with a digital optical cable

The signal is converted to analog in the D/A converter of the

integrated amplifier, for example. Connect the OPTICAL IN

jack on an integrated amplifier to the DIGITAL OUT

OPTICAL jack on this unit.

• The audio of SACD and DSD or input from USB DAC is

not output from the DIGITAL OUT OPTICAL jack of this

unit.

• The digital signals that can be output by this unit are

linear PCM signals with a sampling frequency and

quantization bit rate of 192 kHz/24 bit (operation may not

be possible with all connected devices or environments).

Connecting with a digital coaxial cable

The signal is converted to analog in the D/A converter of the

integrated amplifier, for example. Connect the COAXIAL IN

jack on an integrated amplifier to the DIGITAL OUT

COAXIAL jack on this unit.

• The audio of SACD and DSD or input from USB DAC is

not output from the DIGITAL OUT COAXIAL jack of this

unit.

• The digital signals that can be output by this unit are

linear PCM signals with a sampling frequency and

quantization bit rate of 192 kHz/24 bit (operation may not

be possible with all connected devices or environments).

> Before Start > Part Names >Install > Playback

Advanced Setup | Others

The control jack

If you have multiple Pioneer brand devices, and if they have

CONTROL IN/OUT jacks, you can centrally control them

through the remote controller sensor on the amplifier, for

example. By connecting with monaural miniplug cables

(without resistors) as shown in the diagram, then even if this

unit and other devices are put in locations where they

cannot receive the remote controller signal, you can still use

the remote controller to control this unit or other devices by

pointing the remote controller at the remote controller

sensor on the amplifier, for example.

• Also make sure to connect with the analog audio cable.

Centralized control cannot work correctly with only the

control jack connection.

• The remote controller sensor on this unit stops working if

you connect a monaural miniplug cable (without resistor)

to the CONTROL IN jack of this unit.

• The remote controller sensors on the other devices stop

working if you connect a monaural miniplug cable

(without resistor) to the CONTROL OUT jack of this unit.

• If a Pioneer brand network player and amplifier is

connected by the CONTROL IN/OUT jack, you can

perform basic operations on this unit, the network player,

and amplifier on a smart phone app over a network.

(One example of connection)

CONTROL

OUT

CONTROL

OUT

This unit

Amplifier

Audio device

a Monaural Miniplug Cables (without resistors)

> Before Start > Part Names >Install > Playback

Advanced Setup | Others

Connecting the power cord, etc.

1 2

Power cord connection

This model includes a removable power cord.

The power cord must be connected only after all other

connections are completed. Make sure you first connect the

power cord to AC IN terminal of the unit and then connect to

the outlet. Always disconnect the outlet side first when

disconnecting the power cord.

Starting up

Press 8 STANDBY/ON on the main unit.

• When starting up, press until the button goes in. When

starting up the unit, the 8 STANDBY/ON indicator in the

center of the button lights blue.

a Power Cord

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Playing discs

Playback

Refer to (P18) for discs you can play on this unit.

Playing music CDs

Perform the following procedure when the unit is on.

1. Press CD/SACD on the remote controller to set the

source to CD/SACD.

2. Press ; on the main unit to open the disc tray, and after

putting the disc on the tray, press ; again to close the

tray.

3. Press /h (g) on the remote controller to start play.

4. Use play buttons (h) to stop play or choose tracks to play.

You can also select by entering the track number with

number buttons (b). When entering a 2-digit track

number, press the +10 button as many times as the value

of the second (tens) digit, then press the value of the first

digit. If you press DISPLAY (d), you can switch the

display to show the elapsed time or remaining time of the

disc, etc.

• The content displayed depends on the disc.

Playing a disc with music files

Perform the following procedure when the unit is on.

1. Press CD/SACD on the remote controller to set the

source to CD/SACD.

2. Press ; on the main unit to open the disc tray, and after

putting the disc on the tray, press ; again to close the

tray.

3. Press /h (g) on the remote controller to start play.

4. Use play buttons (h) to stop play or choose tracks to play.

If you press DISPLAY (d), you can switch the display to

show the elapsed time or remaining time of the disc, the

file name of the track, or the track name, etc.

• The content displayed depends on the disc and file.

• Track name display is supported with MP3/WMA/

FLAC/AAC (M4A only)/DSD (DSF only) format music

files only.

• Characters that cannot be displayed by this unit

appear as "".

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Repeat play

1. Repeatedly press REPEAT (a) during play to display

or on the display.

: Repeat play of all tracks.

: Repeat play of the being played track.

To cancel repeat play, press REPEAT (a) several times to

display on the display.

Shuffle play

1. Press SHUFFLE (f) during play or stop to display on

the display.

: Play all tracks randomly.

To cancel shuffle play, press SHUFFLE (f) to display

on the display.

Program play

You can select the order to play tracks on a music CD.

1. Press PROGRAM (e) while stopped.

"P00" is displayed when nothing has been registered.

Enter the track number you want to register with the

number buttons (b). When entering a 2-digit track

number, press the +10 button as many times as the value

of the second (tens) digit, then press the value of the first

digit. The number in "P00" increases each time you

• To play the registered program, press /h (g) on the

remote controller.

• If you press CLEAR (c) while registering tracks, the

tracks are cleared in order, starting from the one you

registered last.

• If you press PROGRAM (e) while registering tracks, all

the tracks you registered are cleared.

• If the total play time of the registered program exceeds

99 minutes 59 seconds, " : " is displayed on the

display.

ALL

OFF

Specifications of files that can be played

* When playing files exceeding 48 kHz, use files that have been recorded on a DVD disc.

Notes regarding all types of files

• Use CD/CD-R/CD-RW discs that conform to the ISO9660 level 1/level 2 CD-ROM file system standard and that are

recorded using the system conforming to extended formatting (Joliet and Romeo). When using DVD discs, then along

with the above, use discs recorded using the UDF file system.

• Folder structure is limited to eight levels and the maximum number of tracks is 3000. However, depending on the folder

structure, not all folders and tracks may be recognized and played.

Notes regarding specific types of files

• Encode WMA files using applications certified by the Microsoft Corporation of the United States. Operation may not be

correct if you use uncertified applications.

• This unit supports play of AAC files with the extension ".m4a" that have been encoded using iTunes. However, play not be

possible if the file has been protected with DRM copy protect (copyright protection) or with some versions of iTunes used

for encoding.

• WAV files include uncompressed PCM digital audio.

• AIFF files include uncompressed PCM digital audio.

Sampling rates Bitrates

Quantization

bit

Types of discs that can be played

Extension

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44.1/48 kHz

Between 8 kbps and

320 kbps and VBR.

–.mp3

WMA 44.1/48 kHz

Between 5 kbps and

192 kbps and VBR.

–.wma

AAC 44.1/48/88.2/96 kHz

Between 8 kbps and

320 kbps and VBR.

–

.aac/

.m4a

WAV

44.1/48/88.2/96/

176.4/192 kHz

– 8/16/24 bit

.wav

AIFF

44.1/48/88.2/96/

176.4/192 kHz

– 8/16/24 bit

.aif/

.aiff

FLAC

44.1/48/88.2/96/

176.4/192 kHz

– 8/16/24 bit

.flac

ALAC

44.1/48/88.2/96/

176.4/192 kHz

– 8/16/24 bit

.m4a

DSD 2.8/5.6 MHz – 1 bit –

.dsf/

.dff

MQA

44.1/48/88.2/96/176.4/

192/352.8/384 kHz

– 8/16/24 bit

.flac/

.wav

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Using this unit as a D/A converter

You can convert the digital audio of the PC to analog on this

unit, and then output it from the ANALOG OUT jacks.

Switching the source

1. Press SOURCE of this unit or the remote controller to

switch the source of the unit to "USB DAC".

Connections

2. Use an A-B type USB cable to connect a computer.

Playback

3. Start play on the player.

• The digital signals that can be input by this unit are linear

PCM signals with a sampling frequency and quantization

bit rate of 48 kHz/32 bit (operation may not be possible

with all connected devices or environments).

• Supported OSs of PC to be connected are Windows10

and Mac OS X.

• With OSs other than the supported ones, the sound may

be interrupted or may not come out.

• Depending on the usage environment, playback may not

be performed normally.

USB DAC

a USB Cable

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Adjusting sound quality

Reproduce the original sound faithfully

(DIRECT mode)

Processing that affects sound quality is shut down so sound

closer to the original is reproduced.

(Default Value): OFF

1. Press DIRECT (d).

• The DIRECT indicator on the front of the main unit lights

when the DIRECT mode is ON.

• When the DIRECT mode is ON, DIGITAL OUT is turned

OFF.

• In DIRECT mode, the display turns off automatically

while playing CD or SACD, or connecting USB DAC.

• When switching the setting during playback, the audio

may be interrupted.

DIGITAL FILTER

Select one of three types of DIGITAL FILTER.

1. The setting changes each time you press DIGITAL

FILTER (a).

"SLOW": Soft and fluid sound

"SHARP" (Default Value): Sound with more structure and

firmness

"SHORT": Sound that starts quick and seems to move

forward

• You can also press SETUP (c) to display the DIGITAL

FILTER setting screen from the SETUP menu. In this

case, select the setting value with / (b) on the remote

controller.

• The setting is fixed to "SHORT" while playing MQA-CD or

a disc containing music files, or using USB DAC.

• When switching the setting during playback, the audio

may be interrupted.

UP SAMPLING

Increasing the sampling frequency helps achieve sound

reproduction with a higher degree of clarity.

(Default Value): OFF

1. You can also press UP SAMPLING (g) to turn the feature

ON and OFF.

• This function cannot be used when the DIRECT mode is

set to ON or during playback of SACD or DSD.

• The setting is fixed to "ON" while playing MQA-CD or a

disc containing music files, or using USB DAC.

• When switching the setting during playback, the audio

may be interrupted.

Adjusting the lock range

(LOCK RANGE ADJUST)

Sound quality is improved by narrowing the lock range to

reduce incidental sounds. However, narrowing the lock

range too much can cause interruptions to sound and noise.

Adjust the lock range while listening to some audio.

(Default Value): RANGE 6

1. Press LOCK RANGE (e).

2. Select the setting value with / (f) on the remote

controller.

"RANGE 6" (broad) to "RANGE 1" (narrow)

• You can also press SETUP (c) to display the LOCK

RANGE ADJUST setting screen from the SETUP menu.

• The setting is fixed to "6" while playing MQA-CD or a disc

containing music files, or using USB DAC.

• LOCK RANGE ADJUST has no effect on the audio of

SACD and DSD.

• When switching the setting during playback, the audio

may be interrupted.

> Before Start > Part Names > Install > Playback

Advanced Setup |Others

Advanced Settings

Advanced Setup

The unit allows you to configure advanced settings to

provide you with an even better experience.

1. Press SETUP on the remote controller.

2. Select the content or the setting with the cursors on the

remote controller and press ENTER to confirm your

selection. To return to the previous screen, press

RETURN.

3. To exit the settings, press SETUP.

AUTO STANDBY

This setting places the unit on standby automatically after

20 minutes of inactivity without any audio input.

"ON" (Default Value): The unit will automatically enter

standby mode.

"OFF": The unit will not automatically enter standby mode.

POWER ON PLAY

You can set it so that the disc automatically starts playing

when this unit is turned on.

• By using an externally connected auto timer, you can use

timer play when the power automatically switches on.

"ON": To play discs automatically

"OFF" (Default Value): When discs are not to be played

DIGITAL OUT

Make settings for digital audio output. When not connecting

to the DIGITAL OUT OPTICAL/COAXIAL jack, you can

listen to even clearer audio by setting this OFF.

"ON" (Default Value), "OFF"

DIGITAL FILTER

You can select the type of DIGITAL FILTER. (P15)

UP SAMPLING

Increasing the sampling frequency helps achieve sound

reproduction with a higher degree of clarity. (P15)

LOCK RANGE ADJUST

Adjust the lock range. (P15)

LOADING MODE

The loading time for CD can be shortened.

• Activating this function allows loading time to be

shortened depending on the CD, however, sound

skipping may occur at the beginning of playback.

"NORMAL" (Default Value): When the loading time for CD is

not shortened

"FAST": When the loading time for CD is shortened

AUTO STANDBY

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Troubleshooting

Others

Before starting the procedure

When operation is unstable, problems may be solved by

simply turning the power on or to standby or disconnecting/

connecting the power cord, rather than reviewing settings

and operations. Try the simple measures on both the unit

and the connected device. If the problem isn't fixed after

referring to "Troubleshooting", resetting the unit to the

status at the time of shipment may solve the problem.

Resetting the unit (this resets the unit settings to

the default)

1. With the power on and no disc inserted, while pressing

and holding g on the main unit, press DIRECT.

2. "CLEAR" is displayed, the unit switches to standby, and

the settings are reset.

■ Power

Cannot turn on the unit

• Unplug the power cord from the wall outlet, wait

2 minutes or more, then plug it in again.

The unit turns off unexpectedly

• The unit automatically switches to standby when the

"AUTO STANDBY" setting in the SETUP menu functions.

The STANDBY indicator on the main unit continues to

flash red and operations are not possible

• Unplug the power cord from the wall outlet, wait

2 minutes or more, then plug it in again. The indicator will

continue to flash, but press 8 STANDBY/ON on the

main unit to turn the main power ON. If this doesn't fix the

issue, there may be a malfunction. Unplug the power

cord from the wall outlet and contact the dealer or our

customer support.

■ The display doesn't light

• It is possible that the display has been turned off by

pressing DISPLAY OFF. Press DISPLAY OFF to turn the

display on.

■ Cannot play discs

• Place the disc in the disc tray so the label is facing up.

• Play may not be possible if the disc is scratched or dirty.

• Sound files that are protected by copyright cannot be

played.

• The disc tray opens if you insert a disc that this unit does

not support.

■ Audio

Sound is interrupted

• Narrowing the lock range too much with the LOCK

RANGE ADJUST setting can cause interruptions to

sound and also may cause noise. Sound interruptions

caused by adjustments to the lock range are not covered

by our guarantees of operation. Listen to some audio

while adjusting the lock range.

There is no digital sound

• Set "DIGITAL OUT" in the SETUP menu to "ON".

• The audio of SACD and DSD or input from USB DAC is

not digital-output.

■ Remote Controller

• Make sure that the batteries are installed with the correct

polarity.

• Install new batteries. Do not mix different types of

batteries, or old and new batteries.

• Make sure that this unit is not subjected to direct

sunshine or inverter-type fluorescent lights. Relocate if

necessary.

• If this unit is installed in a rack or cabinet with colored-

glass doors or if the doors are closed, the remote

controller may not work reliably.

■ D/A converter feature

• Make sure that the devices are properly connected.

• Play audio compatible with the input jacks on this unit.

(P14)

Cannot play audio from computers

• Cancel the muting on your computer.

• Select this unit in the audio output settings on your

computer. If the source of this unit is set to anything other

than "USB DAC", the PC cannot detect this unit.

• If there are multiple applications running on the

computer, shut down those applications that you are not

using.

Sampling frequency is always the same through the

USB DAC input

• Depending on the computer settings, even if the

sampling frequencies of the files being played are

different, they are converted to the same sampling

frequency for output.

Computer sounds other than music are heard through

the USB DAC input

• Depending on the settings on the computer, sounds such

as the computer startup tone or error sounds may be

played through this unit.

■ SACD

• Due to the differences in recording methods, there may

be a difference in volume between SACD and CD.

CLEAR

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

Other notes

■ Discs that can be played

Precautions for Playback

• Compact discs (CDs) with the following logo on the label

surface can be used.

• Note that some discs may not play back because of the

disc characteristics, scratches, contamination or the

recording state.

Playing MQA

This unit includes the MQA (Master Quality Authenticated)

technology, which enables playback of MQA audio files and

streams, delivering the sound of the original master

recording.

This unit is a CD player that can recognise an MQA-CD.

The built-in MQA decoder will restore the high-resolution

signal heard in the studio and confirm it, using the

authentication signature.

Visit www.mqa.co.uk/customer/mqacd for more information.

‘MQA’ or ‘MQA.’ indicates that the product is decoding and

playing an MQA stream or file, and denotes provenance to

ensure that the sound is identical to that of the source

material. ‘MQA.’ indicates it is playing an MQA Studio file,

which has either been approved in the studio by the artist/

producer or has been verified by the copyright owner.

Playing hybrid SACD

Hybrid SACD consist of two layers; the SACD layer and the

CD layer. Press CD/SACD to select the layer you want to

listen to.

Playing DualDisks

"DualDisk" is a disc with video and audio conforming to the

DVD standard on one side, and audio that can be played on

a CD player on the other.

On the audio side that is not the DVD side, play may not

always be possible due to the fact that the disc does not

conform to the physical specifications of standard CDs.

Operations during play

Direct search does not work while playing discs with music

data.

Types of discs that cannot be played on this unit

DVD Video, DVD Audio, CD-G, Video CD, DTS-CD

Notes on discs

• Be careful not to catch your hand or fingers when

opening or closing the disc tray.

• Never use discs which have an unusual shape (such as

hearts or octagons). These types of discs could jam and

damage the unit.

• Some audio CDs with copy-control functionality do not

comply with official CD standards. These are special

discs and cannot be played with this unit.

• Do not use discs with residue from cellophane tape,

rental discs with labels which are peeling off, or discs with

decorative labels. This type of disc could get stuck in the

unit, or could damage the unit.

• Do not leave a disc having a label printed with an inkjet

printer in the unit for a long time. The disc could get stuck

in the unit, or could damage the unit.

■ Cleaning the player

• Normally, wipe the player with a soft cloth. For tough dirt,

apply some neutral detergent diluted in 5 to 6 parts water

to a soft cloth, wring out thoroughly, wipe off the dirt, then

wipe again with a dry cloth.

• Note that getting alcohol, thinner, benzene or insecticide

on the player could cause the print and coating to peel

off. Also, avoid leaving rubber or vinyl products in contact

with the player for long periods of time, as this could

damage the cabinet.

• When using chemical-impregnated wipes, etc., read the

wipe’s cautions carefully.

• When dust attached on the disc tray is hard to remove,

apply an adhesive tape, etc. to remove the dust.

■ Precautions when moving the unit

When moving the unit, remove any discs in it and close the

disc tray. Then press 8 STANDBY/ON on the main unit,

wait for 10 seconds after [OFF] disappears from the display,

and then unplug the power cord. Moving the unit while a

disc is still in it may cause damage.

■ Condensation

Drops of water can form inside this unit if it is taken from a

cold place to a warm room or when a cold room is rapidly

warmed by a heater. This is called condensation. This may

not only cause the unit to malfunction, but it can also

damage the disc or parts of the unit. We recommend

removing discs from the unit if it is not to be used for a

while. If there is a possibility that condensation has formed,

unplug the power cord and allow the unit to stand for at

least 3 hours at room temperature.

MQA-CD

SACD (Super Audio CD)

(2-channel area only)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Before Start > Part Names > Install > Playback

Advanced Setup | Others

General Specifications

■ Analog Audio Output

Rated Output Level and Impedance

• RCA OUT : 2.3 Vrms (1 kHz, 0 dB) / 100 

Frequency Response

• CD: 2 Hz - 20 kHz,

SACD: 2 Hz - 50 kHz (-3 dB)

Signal to Noise Ratio

• CD: 116 dB or more (A-weighting),

SACD: 116 dB or more (A-weighting)

THD+N

• CD: 0.002 % or less,

SACD: 0.002 % or less

■ Digital Audio Input

USB DAC

• Type B, USB Audio Class 1.0

■ Digital Audio Output

Coaxial Digital Output

• RCA Jack, 0.5 Vp-p / 75 

Optical Digital Output

• Optical Jack, -14 - -21 dBm / 660 nm

■ Other

Control In

• Ø3.5 mini-jack (mono)

Control Out

• Ø3.5 mini-jack (mono)

■ General

Power Supply

• AC 220 - 230 V, 50/60 Hz

Power Consumption

•43W

• 0.3 W (In Standby)

AUTO STANDBY

• ON (20 min) / OFF

Dimensions (W  H  D)

• 435 mm  138 mm  413 mm

Weight

• 13.1 kg

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

SUPER AUDIO CD PLAYER

PD-50AE

Mode d'emploi

Avant de Démarrer

Informations de sécurité ......................................................... 2

Ce que contient la boîte .......................................................... 3

Nom des pièces

Panneau frontal ...................................................................... 4

Panneau arrière ...................................................................... 5

Télécommande ....................................................................... 6

Afficheur ................................................................................. 7

Installation

Raccordements avec un amplificateur ................................... 8

Branchement du cordon d'alimentation, etc. .........................11

Lecture

Lecture de disques ............................................................... 12

Utilisation de cet appareil comme convertisseur D/A ........... 14

Réglage de la qualité du son ................................................ 15

Configuration avancée

Configuration avancée........................................................... 16

Autres

Dépannage ........................................................................... 17

Autres remarques.................................................................. 18

Caractéristiques générales.................................................... 19

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Informations de sécurité

Avant de Démarrer

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

8QV\PEROHG¶pFODLUÀpFKpGDQVXQWULDQJOHpTXLODWpUDOHVWGHVWLQp

jDWWLUHUO¶DWWHQWLRQGHO¶XWLOLVDWHXUVXUOHIDLWTXHFHUWDLQVRUJDQHV

LQWHUQHVQRQLVROpVGHO¶DSSDUHLOVRQWWUDYHUVpVSDUXQFRXUDQW

pOHFWULTXHDVVH]GDQJHUHX[SRXUFRQVWLWXHUXQUHVTXHG¶pOHFWURFXWLRQ

8QSRLQWG¶H[FODPDWLRQGDQVXQWULDQJOHpTXLODWpUDOHVW

GHVWLQpjDWWLUHUO¶DWWHQWLRQGHO¶XWLOLVDWHXUVXUGHVLQVWUXFWLRQV

LPSRUWDQWHVUHODWLYHVjO¶HQWUHWLHQHWjO¶XWLOLVDWLRQGXSURGXLW

$77(17,21

3285e9,7(572875,648('¶e/(&752&87,211(3$6(1/(9(5/(

&289(5&/(1,/(3$11($8$55,Ê5($8&81(3,Ê&(5e3$5$%/(

3$5/¶87,/,6$7(851(6(75289(¬/¶,17e5,(85&21),(57287

(175(7,(1¬813(56211(/48$/,),e81,48(0(17

$9(57,66(0(17

3285e9,7(572875,648('¶e/(&752&87,211(3$6

(1/(9(5/(&289(5&/(1,/(3$11($8$55,Ê5($8&81(

3,Ê&(5e3$5$%/(3$5/¶87,/,6$7(851(6(75289(¬

/¶,17e5,(85&21),(57287(175(7,(1¬813(56211(/

48$/,),e81,48(0(17

&HWDSSDUHLOQ¶HVWSDVpWDQFKH3RXUpYLWHUOHVULVTXHVG¶LQFHQGLHHWGH

GpFKDUJHpOHFWULTXHQHSODFH]SUqVGHOXLXQUpFLSLHQWUHPSOLG¶HDXWHO

TX¶XQYDVHRXXQSRWGHÀHXUVHWQHO¶H[SRVH]SDVjGHVJRXWWHVG¶HDX

GHVpFODERXVVXUHVGHODSOXLHRXGHO¶KXPLGLWp

3RXUpYLWHUOHVULVTXHVG¶LQFHQGLHQHSODFH]DXFXQHÀDPPHQXHWHOOH

TX¶XQHERXJLHDOOXPpHVXUO¶DSSDUHLO

1¶XWLOLVH]QLQHFRQVHUYH]YRVSLOHVjODOXPLqUHGLUHFWHGXVROHLORX

GDQVXQHQGURLWIRUWHPHQWH[SRVpjODFKDOHXUFRPPHXQHYRLWXUHRXj

SUR[LPLWpG¶XQDSSDUHLOGHFKDXႇDJH/HVSLOHVULVTXHUDLHQWGHVXLQWHU

VXUFKDXႇHUH[SORVHURXV¶HQÀDPPHU/DGXUpHGHYLHHWODSHUIRUPDQFH

GHVSLOHVSHXYHQWpJDOHPHQWrWUHUpGXLWHV

*DUGH]OHVSLqFHVGHSHWLWHWDLOOHKRUVGHODSRUWpHGHVEpEpVHW

GHVHQIDQWV(QFDVG¶LQJHVWLRQDFFLGHQWHOOHYHXLOOH]FRQWDFWHU

LPPpGLDWHPHQWXQPpGHFLQ

/HVIHQWHVHWRXYHUWXUHVGXFRႇUHWVRQWSUpYXHVSRXUODYHQWLODWLRQ

SRXUDVVXUHUXQIRQFWLRQQHPHQWVWDEOHGHO¶DSSDUHLOHWSRXUpYLWHUVD

VXUFKDXႇH3RXUpYLWHUOHVULVTXHVG¶LQFHQGLHQHERXFKH]MDPDLVOHV

RXYHUWXUHVHWQHOHVUHFRXYUH]SDVG¶REMHWVWHOVTXHMRXUQDX[QDSSHV

RXULGHDX[HWQ¶XWLOLVH]SDVO¶DSSDUHLOSRVpVXUXQWDSLVpSDLVRXXQOLW

,O\DXQULVTXHG¶H[SORVLRQVLODEDWWHULHHVWUHPSODFpHSDUXQHDXWUH

GHW\SHLQFRUUHFW,OH[LVWHXQULVTXHG¶H[SORVLRQHQFDVGHGpS{WGHOD

EDWWHULHGDQVXQIHXRXXQIRXUFKDXGRXHQFRUHHQFDVG¶pFUDVHPHQW

RXGHGpFRXSHPpFDQLTXHGHODEDWWHULH

3UpFDXWLRQV

9HLOOH]jQ¶LQVWDOOHUFHWDSSDUHLOTXHGDQVXQUDFNRXXQPHXEOHTXL

Q¶HQWUDYHSDVODYHQWLODWLRQ

/DLVVH]XQHVSDFHOLEUHGHFPDXGHVVXVHWjF{WpGHO¶DSSDUHLODLQVL

TXHFPHQIDFHDUULqUH/DIDFHDUULqUHGXUDFNRXGXPHXEOHGRLWVH

WURXYHUjFPRXSOXVGXPXUSRXUDVVXUHUXQHDpUDWLRQDGpTXDWHHQ

YXHGHGLVVLSHUODFKDOHXU

0LOLHXGHIRQFWLRQQHPHQW

7HPSpUDWXUHHWKXPLGLWpGXPLOLHXGHIRQFWLRQQHPHQW'H&j&

GH)j)+XPLGLWpUHODWLYHLQIpULHXUHjRUL¿FHVGH

YHQWLODWLRQQRQREVWUXpV

1¶LQVWDOOH]SDVO¶DSSDUHLOGDQVXQHQGURLWPDOYHQWLOpRXXQOLHXVRXPLVj

XQHIRUWHKXPLGLWpRXHQSOHLQVROHLORXjXQHIRUWHOXPLqUHDUWL¿FLHOOH

$YLVLPSRUWDQW

/HQXPpURGHPRGqOHHWOHQXPpURGHVpULHGHFHWpTXLSHPHQWVRQW

VLWXpVjO¶DUULqUHRXHQGHVVRXV1RWH]FHVQXPpURVVXUYRWUHFDUWH

GHJDUDQWLHMRLQWHHWFRQVHUYH]ODGDQVXQHQGURLWVUSRXUXQHIXWXUH

FRQVXOWDWLRQ

$77(17,21

/DWRXFKHLQWHUUXSWHXUGHFHWDSSDUHLOQHFRXSHSDVWRWDOHPHQWOH

FRXUDQWSURYHQDQWGHODSULVHVHFWHXU&RPPHOHFRUGRQG¶DOLPHQWDWLRQ

IDLWRႈFHGHGLVSRVLWLIGHGpFRQQH[LRQGXVHFWHXULOGHYUDrWUH

GpEUDQFKpDXQLYHDXGHODSULVHVHFWHXUSRXUTXHO¶DSSDUHLOVRLW

FRPSOqWHPHQWKRUVWHQVLRQ3DUFRQVpTXHQWYHLOOH]jLQVWDOOHUO¶DSSDUHLO

GHWHOOHPDQLqUHTXHVRQFRUGRQG¶DOLPHQWDWLRQSXLVVHrWUHIDFLOHPHQW

GpEUDQFKpGHODSULVHVHFWHXUHQFDVG¶DFFLGHQW3RXUpYLWHUWRXWULVTXH

G¶LQFHQGLHOHFRUGRQG¶DOLPHQWDWLRQVHUDGpEUDQFKpDXQLYHDXGHOD

SULVHVHFWHXUVLYRXVSUpYR\H]XQHSpULRGHSURORQJpHGHQRQXWLOLVDWLRQ

SDUH[HPSOHDYDQWXQGpSDUWHQYDFDQFHV

&HSURGXLWHVWGHVWLQpjXQHXWLOLVDWLRQGRPHVWLTXHJpQpUDOH7RXWH

SDQQHGXHjXQHXWLOLVDWLRQDXWUHTX¶jGHV¿QVSULYpHVFRPPHXQH

XWLOLVDWLRQjGHV¿QVFRPPHUFLDOHVGDQVXQUHVWDXUDQWGDQVXQDXWRFDU

RXVXUXQEDWHDXHWTXLQpFHVVLWHXQHUpSDUDWLRQVHUDDX[IUDLVGX

FOLHQWPrPHSHQGDQWODSpULRGHGHJDUDQWLH

$WWHQWLRQFRQFHUQDQWOHFRUGRQG¶DOLPHQWDWLRQ

7HQLUOHFRUGRQG¶DOLPHQWDWLRQSDUODSULVH1HMDPDLVGpEUDQFKHUOD

¿FKHHQWLUDQWVXUOHFRUGRQHWQHMDPDLVWRXFKHUOHFRUGRQG¶DOLPHQWDWLRQ

DYHFOHVPDLQVPRXLOOpHVFDUFHODSRXUUDLWFDXVHUXQFRXUWFLUFXLWRXXQH

pOHFWURFXWLRQ1HSDVSODFHUO¶DSSDUHLOXQPHXEOHHWFVXUOHFRUGRQ

G¶DOLPHQWDWLRQRXFRLQFHUOHFRUGRQ1HMDPDLVIDLUHGHQRHXGDYHFOH

FRUGRQRXOHQRXHUDYHFG¶DXWUHVFRUGRQV/HVFRUGRQVG¶DOLPHQWDWLRQ

GRLYHQWrWUHDFKHPLQpVGHPDQLqUHjQHSDVSRXYRLUrWUHpFUDVpV8Q

FRUGRQG¶DOLPHQWDWLRQHQGRPPDJpSHXWFDXVHUXQLQFHQGLHRXXQH

pOHFWURFXWLRQ&RQWU{OHUOHFRUGRQG¶DOLPHQWDWLRQUpJXOLqUHPHQW6¶LOHVW

HQGRPPDJpGHPDQGHUDXVHUYLFHDSUqVYHQWHDXWRULVpOHSOXVSURFKH

RXDXUHYHQGHXUGHOHUHPSODFHU

$77(17,21

&HWDSSDUHLOHVWXQSURGXLWODVHUGH&ODVVHFODVVpVHORQO¶DUWLFOH,(&

UHODWLIjOD6pFXULWpGHVSURGXLWVODVHU

APPAREIL À LASER DE CLASSE 1

,QIRUPDWLRQjGHVWLQDWLRQGHVXWLOLVDWHXUVVXUODFROOHFWH

HWO¶pOLPLQDWLRQGHVpTXLSHPHQWVHWEDWWHULHVXVDJpV

Exemples de marquage

pour les batteries

Marquage pour les

équipements

&HVV\PEROHVTXL¿JXUHQWVXUOHVSURGXLWVOHVHPEDOODJHVHWRX

OHVGRFXPHQWVG¶DFFRPSDJQHPHQWVLJQL¿HQWTXHOHVpTXLSHPHQWV

pOHFWULTXHVHWpOHFWURQLTXHVHWEDWWHULHVXVDJpVQHGRLYHQWSDVrWUH

MHWpVDYHFOHVGpFKHWVPpQDJHUVHWIRQWO¶REMHWG¶XQHFROOHFWHVpOHFWLYH

3RXUDVVXUHUO¶HQOqYHPHQWHWOHWUDLWHPHQWDSSURSULpVGHVSURGXLWVHW

EDWWHULHVXVDJpVPHUFLGHOHVUHWRXUQHUGDQVOHVSRLQWVGHFROOHFWH

VpOHFWLYHKDELOLWpVFRQIRUPpPHQWjODOpJLVODWLRQORFDOHHQYLJXHXU

(QUHVSHFWDQWOHVFLUFXLWVGHFROOHFWHVpOHFWLYHPLVHQSODFHSRXUFHV

SURGXLWVYRXVFRQWULEXHUH]jpFRQRPLVHUGHVUHVVRXUFHVSUpFLHXVHV

HWjSUpYHQLUOHVLPSDFWVQpJDWLIVpYHQWXHOVVXUODVDQWpKXPDLQHHW

O¶HQYLURQQHPHQWTXLSRXUUDLHQWUpVXOWHUG¶XQHPDXYDLVHJHVWLRQGHVGpFKHWV

3RXUSOXVG¶LQIRUPDWLRQVXUODFROOHFWHHWOHWUDLWHPHQWGHVSURGXLWV

HWEDWWHULHVXVDJpVYHXLOOH]FRQWDFWHUYRWUHPXQLFLSDOLWpYRWUH

VHUYLFHGHJHVWLRQGHVGpFKHWVRXOHSRLQWGHYHQWHFKH]TXLYRXV

DYH]DFKHWpFHVSURGXLWV

&HVV\PEROHVQHVRQWYDODEOHVTXHGDQVOHVSD\VGHO¶8QLRQ

(XURSpHQQH

3RXUOHVSD\VQ¶DSSDUWHQDQWSDVjO¶8QLRQ(XURSpHQQH

6LYRXVVRXKDLWH]MHWHUFHVDUWLFOHVYHXLOOH]FRQWDFWHUOHVDXWRULWpV

RXUHYHQGHXUVORFDX[SRXUFRQQDvWUHOHVPpWKRGHVG¶pOLPLQDWLRQ

DSSURSULpHV

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Ce que contient la boîte

1. Appareil principal (1)

2. Télécommande (RC-980C) (1), Piles (AAA/R03) (2)

3. Câble audio analogique (Pour le test) (1)

4. Cordon d'alimentation (1)

• Mode d'emploi (ce document) (1)

• Le cordon d'alimentation devra être branché uniquement lorsque tous les autres

raccordements seront effectués.

• Nous n’acceptons en aucun cas la responsabilité des dommages résultant d'une

connexion à des équipements fabriqués par d'autres sociétés.

• Les spécifications et l'aspect peuvent changer sans préavis.

La mise sous tension ou hors tension ne peut pas être effectuée avec la télécommande.

Utiliser la touche 8 STANDBY/ON de l'appareil principal.

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Panneau frontal

Nom des pièces

1. 8 Touche/témoin STANDBY/ON : Permet de mettre l'appareil sous tension ou hors

tension. Lors du démarrage de l'appareil, le témoin au centre de la touche est bleu.

2. Témoin STANDBY : Est rouge lorsque l'appareil est en mode veille.

3. Plateau du disque : Déposez les disques ici. Vous pouvez également utiliser des disques

de 8 cm.

4. Touche ; : Permet d'ouvrir ou de fermer le plateau à disque.

5. Touches Lecture :

u t : Permet de revenir au début de la piste en cours de lecture. Appuyer une

nouvelle fois pour aller sur la piste précédente. Appuyer longuement pour revenir

rapidement en arrière.

/h : Permet de lire ou de mettre en pause.

y i : Si elle est pressée durant la lecture, permet d'aller sur la piste suivante.

Appuyer longuement pour avancer rapidement dans la piste.

: Cette touche permet d'arrêter la lecture.

6. Capteur de la télécommande

• La plage de réception de la télécommande est d'environ 16´/5 m, à un angle de 20°

dans la direction verticale et à un angle de 30° à gauche et à droite.

7. Touche/témoin CD/SACD : Permet de choisir la source entre CD/SACD. Si vous lisez un

SACD hybride, la couche en cours de lecture change lorsque vous appuyez sur ceci.

(P18)

Le témoin est bleu lorsque SACD est sélectionné.

8. Touche/témoin DIRECT : Permet d'activer ou de désactiver le mode DIRECT. (P15)

Le témoin est bleu lorsque le mode DIRECT est activé.

9. Afficheur (P7)

10.

Touche SOURCE : Permet de changer la source à lire.

11.

Touche SETUP : Affiche le menu SETUP. (P16)

6bkbl87 9

14352

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Panneau arrière

1. Prise ANALOG OUT : Utilisez un câble audio analogique pour connecter un amplificateur

intégré, par exemple.

2. AC IN : Permet de brancher le cordon d'alimentation fourni.

3. Port USB DAC : Permet d'utiliser un câble USB (type A-B) pour raccorder un ordinateur.

4. Prise DIGITAL OUT OPTICAL/COAXIAL : Permet d'utiliser un câble optonumérique ou un

câble coaxial numérique pour raccorder un amplificateur intégré, par exemple.

5. Prise CONTROL IN/OUT : En y raccordant des amplificateurs et des périphériques audio

de marque Pioneer, le contrôle centralisé est possible. Vous pouvez, par exemple,

contrôler les amplificateurs et les périphériques audio.

345

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Télécommande

1. Touche ^ STANDBY/ON : Lorsque l'appareil est sous

tension, ceci permet de mettre l'appareil en marche ou en

veille. La mise sous tension ou hors tension ne peut pas

être effectuée avec la télécommande.

2. Touche SHUFFLE : Permet de sélectionner la lecture

aléatoire. (P13)

3. Touche REPEAT : Permet de sélectionner la répétition de

lecture. (P13)

4. Touches numérotées : Permet de saisir directement le

numéro de la piste d'un CD lors du choix des pistes. Elles

sont également utilisées pour saisir les numéros de piste

de la lecture programmée.

5. Touche CLEAR : Permet d'effacer le contenu défini pour

la lecture programmée. (P13)

6. Touche DIGITAL FILTER : Permet de sélectionner l'un

des trois types de DIGITAL FILTER. (P15)

7. Touches du curseur et ENTER : Permet de sélectionner

l'élément à l'aide des touches du curseur et d'appuyer

sur ENTER pour valider.

8. Touche SETUP : Affiche le menu SETUP. (P16)

9. Touches Lecture :

u : Permet de revenir au début de la piste en cours de

lecture. Appuyer une nouvelle fois pour aller sur la piste

précédente.

/h : Lecture ou pause.

i : Passer à la piste suivante.

t : Appuyer longuement pour revenir rapidement en

arrière dans la piste en cours de lecture.

g : Arrêter la lecture.

y : Appuyer longuement pour avancer rapidement

dans la piste en cours de lecture.

10.

Touche SOURCE: Permet de changer la source à lire.

11.

Touche DIRECT : Permet d'activer ou de désactiver le

mode DIRECT. (P15)

12.

Touche DISPLAY : Permet de modifier les informations

présentes sur l'afficheur.

• Selon la source, il se peut que la commande ne se

lance pas.

13.

Touche ; OPEN/CLOSE : Permet d'ouvrir ou de fermer

le plateau à disque.

14.

Touche PROGRAM : Utilisée pour la lecture

programmée. (P13)

15.

Touche LOCK RANGE : Permet d'afficher l'écran des

paramètres LOCK RANGE ADJUST. (P15)

16.

Touche RETURN : Permet à l'affichage de retourner à

son état précédent.

17.

Bouton UP SAMPLING : Commutez la fonction UP

SAMPLING sur ON et OFF. (P15)

18.

Touche CD/SACD : Permet de choisir la source entre

CD/SACD. Si vous lisez un SACD hybride, la couche en

cours de lecture change lorsque vous appuyez sur ceci.

(P18)

19.

Touche DIGITAL OUT : Permet d'activer ou de désactiver

la sortie numérique. (P16)

20.

Touche DISPLAY OFF : Appuyer pour éteindre l'afficheur

de cet appareil. Appuyer une nouvelle fois pour allumer

l'afficheur.

21.

Touche DIMMER : Permet de régler la luminosité de

l'afficheur sur trois niveaux. (Valeur par défaut : Niveau 3)

bl bt

bm ck

Faire correspondre la

polarité en insérant les

piles.

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Afficheur

1. Est allumé durant la lecture d'un SACD et du format DSD.

2. Afficheur des messages : Permet d'afficher les informations des pistes et des menus.

3. S'allume lorsque les commandes à l'aide des touches du curseur de la télécommande

sont possibles.

4. Affiche l'état de la lecture.

5. S'allume lorsque le paramètre de la sortie audio numérique est activé. (P16)

6. S'allume pour montrer des éléments tels que la durée restante d'une piste ou d'un disque,

ou la durée totale du disque.

7. S’affiche lorsqu’un flux ou un fichier MQA est lu. Pour des détails, consultez

"Lecture MQA". (P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Raccordements avec un amplificateur

Installation

Écoutez le son provenant des disques lus par cet appareil

et des périphériques raccordés à celui-ci par les systèmes

d'enceintes raccordés à des amplificateurs intégrés ou à

des récepteurs AV. Raccordez selon les prises d'entrée de

votre amplificateur.

Raccordement à l'aide d'un câble audio

analogique

Le signal est converti en analogique par le convertisseur D/A

de cet appareil puis reproduit vers un amplificateur intégré, par

exemple. Raccordez les prises LINE IN d'un amplificateur

intégré à la prise ANALOG OUT (prise RCA) de cet appareil.

Cet appareil

Amplificateur intégré, récepteur AV, etc.

a Câble audio analogique

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Raccordement à l'aide d'un câble

optonumérique

Le signal est converti en analogique par le convertisseur

D/A de l'amplificateur intégré, par exemple. Raccordez la

prise OPTICAL IN d'un amplificateur intégré à la prise

DIGITAL OUT OPTICAL de cet appareil.

• L’audio du SACD et du DSD ou l’entrée du USB DAC ne

sont pas restitués à partir de la prise DIGITAL OUT

OPTICAL de cette unité.

• Les signaux numériques pouvant être reproduits par cet

appareil sont des signaux PCM linéaires avec une

fréquence d'échantillonnage et un débit de quantification

de 192 kHz/24 bits (Le fonctionnement pourrait ne pas

être possible avec tous les périphériques raccordés ou

tous les environnements).

Raccordement à l'aide d'un câble coaxial

numérique

Le signal est converti en analogique par le convertisseur

D/A de l'amplificateur intégré, par exemple. Raccordez la

prise COAXIAL IN d'un amplificateur intégré à la prise

DIGITAL OUT COAXIAL de cet appareil.

• L’audio du SACD et du DSD ou l’entrée du USB DAC ne

sont pas restitués à partir de la prise DIGITAL OUT

COAXIAL de cette unité.

• Les signaux numériques pouvant être reproduits par cet

appareil sont des signaux PCM linéaires avec une

fréquence d'échantillonnage et un débit de quantification

de 192 kHz/24 bits (Le fonctionnement pourrait ne pas

être possible avec tous les périphériques raccordés ou

tous les environnements).

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

La prise de contrôle

Si vous possédez plusieurs appareils de marque Pioneer et

que ceux-ci sont munis de prises CONTROL IN/OUT, vous

pouvez tous les contrôler par le biais du capteur de

télécommande de l'amplificateur, par exemple. En

branchant des câbles de connexion avec mini-prise

monophonique (sans résistance) comme montré sur le

schéma, même si cet appareil et les autres périphériques

sont placés à des endroits où la réception du signal de la

télécommande est impossible, vous pouvez toujours utiliser

la télécommande pour les contrôler en la pointant vers le

capteur de télécommande de l'amplificateur, par exemple.

• Assurez-vous d'effectuer également le raccordement

avec le câble audio analogique. Le contrôle centralisé ne

peut pas fonctionner correctement avec seulement le

raccordement de la prise de contrôle.

• Le capteur de télécommande présent sur cet appareil

arrête de fonctionner si vous raccordez un câble de

connexion avec mini-prise monophonique (sans

résistance) à la prise CONTROL IN de cet appareil.

• Les capteurs de télécommande présents sur les autres

appareils arrêtent de fonctionner si vous raccordez un

câble de connexion avec mini-prise monophonique (sans

résistance) à la prise CONTROL OUT de cet appareil.

• Si un lecteur réseau et un amplificateur de marque

Pioneer sont raccordés par la prise CONTROL IN/OUT,

vous pouvez effectuer les commandes de base sur cet

appareil, le lecteur réseau et l'amplificateur à l'aide d'une

application pour smartphone par le biais du réseau.

(Un exemple de raccordement)

CONTROL

OUT

CONTROL

OUT

Cet appareil

Amplificateur

Périphérique

audio

a Câbles de connexion avec mini-prise monophonique

(sans résistance)

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Branchement du cordon d'alimentation, etc.

1 2

Branchement du cordon d'alimentation

Ce modèle dispose d’un cordon d’alimentation amovible.

Le cordon d'alimentation doit être connecté uniquement

lorsque toutes les autres connexions sont effectuées.

Assurez-vous de brancher d'abord le cordon d'alimentation

à la prise AC IN de l'appareil puis de le brancher à la prise

d'alimentation. Toujours débrancher de la prise en premier

lorsque vous retirez le cordon d'alimentation.

Démarrage

Appuyez sur la touche 8 STANDBY/ON de l'appareil

principal.

• Appuyez jusqu'à ce que la touche reste enfoncée. Lors

du démarrage de l'appareil, le témoin 8 STANDBY/ON

au centre de la touche est bleu.

a Cordon d’alimentation

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Lecture de disques

Lecture

Consultez la (P18) pour savoir quels disques vous

pouvez lire avec cet appareil.

Lecture de CD musicaux

Effectuez la procédure suivante lorsque l'appareil est en marche.

1. Appuyez sur la touche CD/SACD de la télécommande

pour régler la source sur CD/SACD.

2. Appuyez sur la touche

;

de l'appareil principal pour ouvrir le

plateau à disque et, après avoir introduit un disque, appuyez

une nouvelle fois sur

;

pour fermer le plateau.

3. Appuyez sur la touche /h (g) de la télécommande pour

démarrer la lecture.

4. Utilisez les touches de lecture (h) pour arrêter la lecture ou

choisir les pistes à lire. Vous pouvez également effectuer la

sélection en saisissant le numéro de la piste à l'aide des

touches numérotées (b). Pour saisir un numéro de piste à

2 chiffres, appuyez plusieurs fois sur la touche +10 comme

valeur du second chiffre (dizaines), puis appuyez sur la

valeur du premier chiffre. Si vous appuyez sur DISPLAY (d),

vous pouvez modifier ce qui apparait sur l'afficheur pour

montrer la durée écoulée ou restante du disque, etc.

• Le contenu affiché dépend du disque.

Lecture d'un disque avec fichiers musicaux

Effectuez la procédure suivante lorsque l'appareil est en marche.

1. Appuyez sur la touche CD/SACD de la télécommande

pour régler la source sur CD/SACD.

2. Appuyez sur la touche

;

de l'appareil principal pour ouvrir le

plateau à disque et, après avoir introduit un disque, appuyez

une nouvelle fois sur

;

pour fermer le plateau.

3. Appuyez sur la touche /h (g) de la télécommande pour

démarrer la lecture.

4. Utilisez les touches de lecture (h) pour arrêter la lecture

ou choisir les pistes à lire. Si vous appuyez sur DISPLAY

(d), vous pouvez modifier ce qui apparait sur l'afficheur

pour montrer la durée écoulée ou restante du disque, le

nom de fichier de la piste, ou bien le nom de la piste, etc.

• Le contenu affiché dépend du disque et du fichier.

• L'affichage du nom de la piste est uniquement pris en

charge pour les fichiers musicaux aux formats MP3/WMA/

FLAC/AAC (M4A uniquement)/DSD (DSF uniquement).

• Les caractères qui ne peuvent pas être affichés par cet

appareil sont remplacés par "".

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Répétition de lecture

1. Appuyez plusieurs fois sur REPEAT (a) pendant la lecture

pour faire apparaitre ou sur l'afficheur.

: Permet de répéter la lecture de toutes les pistes.

: Permet de répéter la lecture de la piste en cours de

lecture.

Pour annuler la lecture en boucle, appuyez plusieurs fois

sur REPEAT (a) pour faire apparaitre sur l’affichage.

Lecture aléatoire

1. Appuyez sur SHUFFLE (f) durant la lecture ou un arrêt

pour afficher sur l’affichage.

: Permet de lire aléatoirement toutes les pistes.

Pour annuler la lecture aléatoire, appuyez sur SHUFFLE

(f) pour faire apparaitre sur l’affichage.

Lecture programmée

Vous pouvez choisir l'ordre de lecture des pistes d'un CD.

1. Appuyez sur PROGRAM (e) pendant l'arrêt.

"P00" s'affiche si rien n'a été mémorisé. Saisissez le

numéro de la piste que vous désirez mémoriser à l'aide

des touches numérotées (b). Pour saisir un numéro de

piste à 2 chiffres, appuyez plusieurs fois sur la touche +10

comme valeur du second chiffre (dizaines), puis appuyez

sur la valeur du premier chiffre. Le numéro dans "P00"

augmente chaque fois que vous mémorisez une piste. Il

est possible de mémoriser jusqu'à 24 pistes.

• Pour lire le programme mémorisé, appuyez sur la

touche /h (g) de la télécommande.

• Si vous appuyez sur la touche CLEAR (c) durant la

mémorisation des pistes, les pistes sont effacées dans

l'ordre, en commençant par celle que vous avez

mémorisée en dernier.

• Si vous appuyez sur la touche PROGRAM (e) durant la

mémorisation des pistes, toutes les pistes que vous

avez mémorisées sont effacées.

• Si la durée totale de lecture du programme enregistré

dépasse 99 minutes 59 secondes, " : " apparait

sur l’affichage.

ALL

OFF

Caractéristiques des fichiers pouvant être lus

* Pour lire des fichiers dépassant 48 kHz, utilisez ceux enregistrés sur un DVD.

Remarques à propos de tous les types de fichiers

• Utilisez des disques CD/CD-R/CD-RW conformes à la norme du système de fichiers sur CD-ROM ISO9660 niveau 1/

niveau 2 et qui ont été enregistrés à l'aide du système de format étendu (Joliet et Romeo). Si vous désirez utiliser des

DVD, avec ce qui précède, utilisez des disques enregistrés à l'aide du système de fichiers UDF.

• La structure de dossier est limitée à huit niveaux et à un nombre maximum de 3000 pistes. Cependant, en fonction de la

structure du dossier, tous les dossiers et toutes les pistes pourraient ne pas pouvoir être lus.

Remarques à propos de types spécifiques de fichiers

• Encodez des fichiers WMA à l'aide d'applications certifiées par la société Microsoft des États-Unis. Le fonctionnement

pourrait ne pas être bon si vous utilisez des applications non certifiées.

• Cet appareil prend en charge la lecture des fichiers AAC ayant l'extension ".m4a" encodés à l'aide d'iTunes. Cependant,

la lecture pourrait être impossible si le fichier a été protégé contre la copie par DRM (protection du droit d'auteur) ou avec

certaines versions d'iTunes utilisées pour l'encodage.

• Les fichiers WAV comprennent des données audio numériques PCM non compressées.

• Les fichiers AIFF comprennent des données audio numériques PCM non compressées.

Taux

d'échantillonnage

Débits binaires

Bits de

quantification

Types de disques pouvant être lus

Extension

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44,1/48 kHz

Entre 8 kbps,

320 kbps et VBR.

–.mp3

WMA 44,1/48 kHz

Entre 5 kbps,

192 kbps et VBR.

–.wma

AAC 44,1/48/88,2/96 kHz

Entre 8 kbps,

320 kbps et VBR.

–

.aac/

.m4a

WAV

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bits

.wav

AIFF

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bits

.aif/

.aiff

FLAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bits

.flac

ALAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bits

.m4a

DSD 2,8/5,6 MHz – 1 bits –

.dsf/

.dff

MQA

44,1/48/88,2/96/176,4/

192/352,8/384 kHz

– 8/16/24 bits

.flac/

.wav

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Utilisation de cet appareil comme convertisseur D/A

Vous pouvez convertir l’audio numérique du PC en

analogique sur cette unité, puis le restituer à partir des

prises ANALOG OUT.

Changement de la source

1. Appuyez sur SOURCE sur cette unité ou sur la

télécommande pour commuter la source de l’unité sur

"USB DAC".

Connexions

2. Utilisez un câble USB de type A-B pour raccorder un

ordinateur.

Lecture

3. Démarrez la lecture sur le lecteur.

• Les signaux numériques entrant par cet appareil sont

des signaux PCM linéaires avec une fréquence

d'échantillonnage et un débit de quantification de 48 kHz/

32 bits (Le fonctionnement pourrait ne pas être possible

avec tous les périphériques raccordés ou tous les

environnements).

• Les SE supportés du PC à connecter sont Windows10

et Mac OS X.

• Avec des SE différents de ceux supportés, le son risque

d’être interrompu ou de ne pas être émis.

• Selon l’environnement d’utilisation, la lecture risque de

ne pas être effectuée normalement.

USB DAC

a Câble USB

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Réglage de la qualité du son

Reproduire fidèlement le son original

(mode DIRECT)

Le traitement qui affecte la qualité audio est désactivé ce

qui fait qu'un son proche de l'original est reproduit.

(Valeur par défaut) : OFF

1. Appuyez sur DIRECT (d).

• Le témoin DIRECT à l'avant de l'appareil principal

s'allume lorsque le mode DIRECT est sur ON.

• Lorsque le mode DIRECT est sur ON, DIGITAL OUT est

mis sur OFF.

• En mode DIRECT, l’affichage s’éteint automatiquement

lors de la lecture d’un CD ou d’un SACD, ou d’une

connexion USB DAC.

• L’audio risque d’être interrompu en cas de changement

de réglage durant la lecture.

DIGITAL FILTER

Permet de sélectionner l'un des trois types de DIGITAL

FILTER.

1. Le paramètre change chaque fois que vous appuyez sur

DIGITAL FILTER (a).

"SLOW" : Son doux et fluide

"SHARP" (Valeur par défaut) : Son ayant davantage de

structure et de fermeté

"SHORT" : Son qui démarre rapidement et donne

l'impression d'un déplacement vers l'avant

• Vous pouvez également appuyer sur SETUP (c) pour

afficher l'écran de réglage DIGITAL FILTER depuis le

menu SETUP. Dans ce cas, sélectionnez la valeur de

réglage à l'aide des touches / (b) de la

télécommande.

• Le réglage est fixé sur "SHORT" lors de la lecture d’un

MQA-CD ou d’un disque contenant des fichiers

musicaux, ou de l’utilisation de USB DAC.

• L’audio risque d’être interrompu en cas de changement

de réglage durant la lecture.

UP SAMPLING

L'augmentation de la fréquence d'échantillonnage aide à

obtenir une reproduction sonore ayant un degré plus élevé

de clarté.

(Valeur par défaut) : OFF

1. Vous pouvez également appuyez sur UP SAMPLING (g)

pour régler la fonction sur ON et OFF.

• Cette fonction ne peut pas être utilisée lorsque le mode

DIRECT est réglé sur ON ou durant la lecture d’un SACD

ou d’un DSD.

• Le réglage est fixé sur "ON" lors de la lecture d’un

MQA-CD ou d’un disque contenant des fichiers

musicaux, ou de l’utilisation de USB DAC.

• L’audio risque d’être interrompu en cas de changement

de réglage durant la lecture.

Réglage de la plage de verrouillage

(LOCK RANGE ADJUST)

La qualité du son est améliorée par la réduction de la plage

de verrouillage minimisant les bruits de fond. Cependant,

une réduction trop importante de la plage de verrouillage

peut causer des coupures du son et des parasites sonores.

Réglez la plage de verrouillage tout en écoutant du son.

(Valeur par défaut) : RANGE 6

1. Appuyez sur LOCK RANGE (e).

2. Sélectionnez la valeur de réglage à l'aide des touches

/ (f) de la télécommande.

"RANGE 6" (large) à "RANGE 1" (étroit)

• Vous pouvez également appuyer sur SETUP (c) pour

afficher l'écran de réglage LOCK RANGE ADJUST

depuis le menu SETUP.

• Le réglage est fixé sur "6" lors de la lecture d’un MQA-CD

ou d’un disque contenant des fichiers musicaux, ou de

l’utilisation de USB DAC.

• LOCK RANGE ADJUST n'a aucun effet sur le son du

SACD et du format DSD.

• L’audio risque d’être interrompu en cas de changement

de réglage durant la lecture.

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée |Autres

Configuration avancée

L'appareil vous permet de configurer les paramètres

avancés pour qu'ils vous fournissent une expérience encore

meilleure.

1. Appuyez sur SETUP de la télécommande.

2. Sélectionnez le contenu ou le paramètre avec les

touches du curseur de la télécommande et appuyez sur

ENTER pour valider votre sélection. Pour retourner à

l'écran précédent, appuyez sur RETURN.

3. Pour quitter les réglages, appuyez sur SETUP.

AUTO STANDBY

Ce réglage met automatiquement l’appareil en veille après

20 minutes d’inactivité sans aucune entrée audio.

"ON" (Valeur par défaut) : L’appareil passera

automatiquement en mode veille.

"OFF" : L'appareil ne passe pas automatiquement en mode

veille.

POWER ON PLAY

Vous pouvez le régler pour que le disque démarre

automatiquement la lecture lorsque cet appareil est mis en

marche.

• En utilisant une minuterie automatique externe, vous

pouvez utiliser la lecture en mode minuterie lors de la

mise automatique sous tension.

"ON" : Pour lire automatiquement des disques

"OFF" (Valeur par défaut) : Lorsqu'aucun disque ne doit être

DIGITAL OUT

Effectuez les réglages pour la sortie audio numérique. Si la

prise DIGITAL OUT OPTICAL/COAXIAL n'est pas

raccordée, vous pouvez entendre un son encore plus clair

en réglant ceci sur OFF.

"ON" (Valeur par défaut), "OFF"

DIGITAL FILTER

Vous pouvez choisir le type de DIGITAL FILTER. (P15)

UP SAMPLING

L'augmentation de la fréquence d'échantillonnage aide à

obtenir une reproduction sonore ayant un degré plus élevé

de clarté. (P15)

LOCK RANGE ADJUST

Réglage de la plage de verrouillage. (P15)

LOADING MODE

Il est possible de raccourcir le temps de chargement d’un

CD.

• L’activation de cette fonction permet de raccourcir le

temps de chargement selon le CD, cependant, le son

risque de sauter au début de la lecture.

"NORMAL" (Valeur par défaut) : Lorsque le temps de

chargement du CD n’est pas raccourci

"FAST" : Lorsque le temps de chargement du CD est

raccourci

AUTO STANDBY

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Dépannage

Autres

Avant de démarrer la procédure

Lorsque le fonctionnement est instable, les problèmes

peuvent être résolus simplement en mettant l'appareil sous

tension ou en veille, ou en débranchant/rebranchant le

cordon d'alimentation, plutôt qu'en passant en revue les

réglages et les commandes. Essayez d'effectuer les

mesures les plus simples à la fois sur l'appareil et sur le

périphérique connecté. Si consulter "Dépannage" ne résout

pas le problème, réinitialiser l'appareil dans l'état dans

lequel il était au moment de l'achat peut le résoudre.

Réinitialisation de l'appareil (ceci réinitialise les

paramètres de cet appareil sur leur valeur par défaut)

1. Avec l'appareil en marche et aucun disque présent,

appuyez longuement sur la touche g de l'appareil

principal, en même temps que sur DIRECT.

2. "CLEAR" s'affiche, l'appareil se met en veille et les

réglages sont réinitialisés.

■ Alimentation

Impossible d'allumer cet appareil

• Débranchez le cordon d'alimentation de la prise murale,

attendez au moins 2 minutes, puis rebranchez-le une

nouvelle fois.

L'appareil s'éteint de manière inattendue

• L'appareil passe automatiquement en mode veille

lorsque le paramètre "AUTO STANDBY" dans les

fonctions du menu SETUP.

Le témoin STANDBY sur l'appareil principal continue de

clignoter en rouge et aucune action n'est possible.

• Débranchez le cordon d'alimentation de la prise murale,

attendez 2 minutes ou plus, puis branchez-le une

nouvelle fois. Le témoin continue de clignoter, mais

appuyez sur la touche 8 STANDBY/ON de l'appareil

principal pour mettre sur ON. Si cela ne règle pas le

problème, il pourrait y avoir un dysfonctionnement.

Débranchez le cordon d'alimentation de la prise murale

et contactez le revendeur ou notre service après-vente.

■ L'afficheur ne s'allume pas

• Il est possible que l'afficheur ait été éteint par une

pression sur DISPLAY OFF. Appuyez sur la touche

DISPLAY OFF pour allumer l'afficheur.

■ Impossible de lire des disques

• Placez le disque sur le plateau en mettant l'étiquette vers

le haut.

• La lecture peut ne pas être possible si le disque est rayé

ou sale.

• Les fichiers audio qui sont protégés par droits d'auteur ne

peuvent pas être lus.

• Le plateau à disque s'ouvre si vous introduisez un disque

que cet appareil ne prend pas en charge.

■ Audio

Le son est interrompu

• Une réduction trop importante de la plage de verrouillage

avec le paramètre LOCK RANGE ADJUST peut causer

des coupures du son ainsi que des parasites sonores.

Les coupures du son causées par des réglages de la

plage de verrouillage ne sont pas couvertes par notre

garantie de fonctionnement. Écoutez du son pendant le

réglage de la plage de verrouillage.

Il n'y a pas de son numérique

• Réglez "DIGITAL OUT" dans le menu SETUP sur "ON".

• L’audio du SACD et du DSD ou l’entrée du USB DAC ne

sont pas restitués en numérique.

■ Télécommande

• Assurez-vous que les piles ont été insérées en

respectant la polarité.

• Insérez des piles neuves. Ne mélangez pas différents

types de piles ou des piles neuves et usagées.

• Assurez-vous que cet appareil n'est pas exposé à la

lumière directe du soleil ou à un éclairage fluorescent

inverseur. Déplacez à nouveau si nécessaire.

• Si cet appareil est installé sur une étagère ou dans un

meuble avec des portes en verre teinté ou si les portes

sont fermées, la télécommande peut ne pas fonctionner

correctement.

■ Fonctionnalité convertisseur D/A

• Assurez-vous que les périphériques sont correctement

raccordés.

• Lisez le son compatible avec les prises d'entrée de cet

appareil. (P14)

Impossible de lire le son provenant des ordinateurs

• Annulez la sourdine sur votre ordinateur.

• Sélectionnez cet appareil dans les paramètres de sortie

audio sur votre ordinateur. Si la source de cette unité est

réglé sur autre chose que "USB DAC", le PC ne peut pas

détecter cette unité.

• Si plusieurs applications tournent sur l'ordinateur, quittez

les applications que vous n'utilisez pas.

La fréquence d'échantillonnage est toujours la même

par le biais de l'entrée USB DAC

• En fonction des paramètres de l'ordinateur, même si les

fréquences d'échantillonnage des fichiers en cours de

lecture sont différentes, elles sont converties vers la

même fréquence d'échantillonnage pour la sortie.

Les sons de l'ordinateur autres que la musique sont

audibles au travers de l'entrée USB DAC

• En fonction des paramètres de l'ordinateur, les sons

comme les bips de démarrage ou d'erreurs peuvent être

lus par le biais de cet appareil.

■ SACD

• À cause des différences dans les méthodes d'enregistrement, il

peut y avoir une différence de volume entre un SACD et un CD.

CLEAR

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Autres remarques

■ Disques pouvant être lus

Précautions pour la lecture

• Les disques compacts (CD) dont la surface comporte le

logo suivant peuvent être utilisés.

• Notez que certains disques peuvent ne pas être lus en

raison de leurs caractéristiques, de la présence de

rayures, de saleté ou de l’état de l’enregistrement.

Lecture MQA

Cette unité inclut la technologie MQA (Master Quality

Authenticated), qui permet la lecture flux et de fichiers audio

MQA, restituant le son de l’enregistrement d’origine.

Cette unité est un lecteur CD pouvant reconnaitre un

MQA-CD. Le décodeur MQA intégré rétablira le signal

haute résolution entendu en studio et le confirmera, en

utilisant la signature d’authentification.

Rendez-vous sur www.mqa.co.uk/customer/mqacd pour

plus d’informations.

‘MQA’ ou ‘MQA.’ indiquent que le produit est en train de

décoder et de lire un flux ou un fichier MQA, et indique la

provenance pour assurer que le son est identique à celui du

matériel source. ‘MQA.’ indique la lecture d’un fichier MQA

Studio, qui a été approuvé en studio par l’artiste/le

producteur ou qui a été vérifié par le propriétaire des droits

d’auteur.

Lecture d'un SACD hybride

Un SACD hybride est constitué de deux couches; la couche

SACD et la couche CD. Appuyez sur CD/SACD pour

sélectionner la couche que vous souhaitez écouter.

Lecture des DualDisk

Le "DualDisk" est un disque comportant de la vidéo et du

son conformément à la norme DVD sur un côté, et du son

pouvant être lu sur un lecteur CD de l'autre.

Sur le côté audio qui n'est pas le côté DVD, la lecture pourrait

ne pas être toujours possible du fait que le disque n'est pas

conforme aux caractéristiques physiques des CD habituels.

Commandes durant la lecture

La recherche directe ne fonctionne pas durant la lecture de

disques avec des données musicales.

Types de disques ne pouvant pas être lus par cet

appareil

DVD Video, DVD Audio, CD-G, Video CD, DTS-CD

Remarques sur les disques

• Veillez à ne pas vous coincer les mains ou les doigts en

ouvrant ou en fermant le plateau à disque.

• N'utilisez jamais de disques ayant des formes

inhabituelles (octogonales ou en forme de cœur par

exemple). Ce type de disques peut se coincer et

endommager l'appareil.

• Certains CD audio comportant la fonctionnalité « Copy

Control » ne répondent pas aux normes officielles en

matière de CD. Il s’agit de disques spéciaux qui ne

peuvent pas être lus sur cet appareil.

• N'utilisez pas de disques avec des résidus de ruban

adhésif, des disques de location avec des étiquettes qui

se décollent, ou des disques avec des étiquettes

décoratives. Ce type de disque peut rester coincé dans

l'appareil, ou endommager l'appareil.

• Ne laissez pas un disque dont l’étiquette a été imprimée

avec une imprimante à jet d'encre dans l’appareil

pendant une période prolongée. Le disque peut rester

coincé dans l'appareil ou l’endommager.

■ Nettoyage du lecteur

• Normalement, essuyez le lecteur avec un chiffon doux.

Pour enlever les taches rebelles, imprégnez le chiffon

d’un détergent neutre dilué dans 5 à 6 fois plus d’eau,

tordez bien le chiffon, essuyez la saleté, puis passez un

chiffon sec sur lecteur.

• Notez que les inscriptions et le revêtement du lecteur

peuvent être endommagés par l’alcool, les diluants, le

benzène et les insecticides. Évitez aussi de laisser des

produits en caoutchouc ou en vinyle très longtemps au

contact du lecteur, car ils pourraient endommager le coffret.

• Lorsque vous utilisez des lavettes imprégnées de produit

chimique, etc. lisez attentivement les précautions à prendre.

• Lorsque de la poussière sur le plateau à disque est

difficile à enlever, appliquez du ruban adhésif, etc. pour

enlever la poussière.

■

Précautions lors du déplacement de l'appareil

Pour déplacer l'appareil, retirez tous les disques et fermez le

plateau à disque. Puis appuyez sur la touche

STANDBY/

ON de l'appareil principal, attendez 10 secondes après la

disparition de [OFF] de l'afficheur, et débranchez le cordon

d'alimentation. Déplacer l'appareil alors qu'un disque se trouve

à l'intérieur peut causer des dommages.

■ Condensation

Des gouttes d’eau peuvent se former à l’intérieur de

l’appareil si celui-ci est transporté depuis un endroit froid

vers une pièce chaude, ou lorsqu’une pièce froide est

rapidement chauffée. Ce phénomène est appelé

condensation. Il peut provoquer un dysfonctionnement de

l’appareil, mais également endommager le disque ou

certaines parties de l’appareil. Nous vous conseillons de

retirer les disques de l’appareil lorsque celui-ci ne doit pas

être utilisé pendant une période prolongée. S’il est possible

que de la condensation se soit formée, débranchez le

cordon d'alimentation et laissez l’appareil au repos pendant

au moins 3 heures à température ambiante.

MQA-CD

SACD (Super Audio CD)

(Zone 2 canaux uniquement)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Avant de Démarrer > Nom des pièces > Installation > Lecture

Configuration avancée | Autres

Caractéristiques générales

■ Sortie audio analogique

Niveau de sortie et impédance nominale

• RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100 

Réponse en fréquence

• CD: 2 Hz - 20 kHz,

SACD : 2 Hz - 50 kHz (-3 dB)

Rapport signal-bruit

• CD: 116 dB ou plus (pondération A),

SACD : 116 dB ou plus (pondération A)

THD+N

• CD: 0,002 % ou moins,

SACD: 0,002 % ou moins

■ Entrée audio numérique

USB DAC

• Type B, USB Audio Classe 1.0

■ Sortie audio numérique

Sortie numérique coaxiale

• Prise RCA, 0,5 Vp-p / 75 

Sortie optonumérique

• Prise optique, -14 - -21 dBm / 660 nm

■ Autre

Entrée Contrôle

• Mini prise Ø3,5 (mono)

Sortie Contrôle

• Mini prise Ø3,5 (mono)

■ Général

Alimentation

• CA 220 - 230 V, 50/60 Hz

Consommation d'énergie

•43W

• 0,3 W (en Veille)

AUTO STANDBY

• ON (20 min) / OFF

Dimensions (L  H  P)

• 435 mm  138 mm  413 mm

Poids

• 13,1 kg

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

SUPER AUDIO CD PLAYER

PD-50AE

Manual de

instrucciones

Antes de empezar

Información de seguridad ....................................................... 2

Qué se encuentra en la caja ................................................... 3

Nombres de las piezas

Panel frontal ........................................................................... 4

Panel trasero .......................................................................... 5

Mando a distancia .................................................................. 6

Pantalla ................................................................................... 7

Instalación

Conexiones con un amplificador ............................................ 8

Conexión del cable de alimentación, etc. ..............................11

Reproducción

Reproducción de discos ....................................................... 12

Usar esta unidad como convertidor D/A ............................... 14

Ajuste de la calidad de sonido .............................................. 15

Configuración avanzada

Configuración avanzada........................................................ 16

Otros

Resolución de problemas ..................................................... 17

Otras notas............................................................................ 18

Especificaciones generales................................................... 19

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Información de seguridad

Antes de empezar

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

(OVtPERORGHUD\RFRQFDEH]DGHÀHFKDLQVFULWRHQXQ

WULiQJXORHTXLOiWHURWLHQHOD¿QDOLGDGGHDYLVDUDOXVXDULROD

SUHVHQFLDGH³WHQVLRQHVSHOLJURVDV´QRDLVODGDVGHQWURGHOD

FDMDGHOSURGXFWTXHVRQGHPDJQLWXGVX¿FLHQWHFRPRSDUD

FRQVWLWXLUXQULHVJRGHGHVFDUJDVHOpFWULFDVDSHUVRQDV

(OVLJQRGHH[FODPDFLyQLQVFULWRHQXQWULiQJXORHTXLOiWHUR

WLHQHOD¿QDOLGDGGHDYLVDUDOXVXDULRODSUHVHQFLDGH

LQVWUXFFLRQHVLPSRUWDQWHVGHRSHUDWLyQ\PDQWHQLPLHQWR

UHSDUDFLyQHQODOLWHUDWXUDTXHDFRPSDxDDHVWHSURGXFWR

35(&$8&,Ï1

3$5$35(9(1,5(/3(/,*52'(&+248((/e&75,&212

5(029(5/$7$3$1,/$63$57(6'(17521287,/,=$'$6

//$0$581$3(5621$&8$/,),&$'$

$'9(57(1&,$

3$5$35(9(1,5(/3(/,*52'(&+248((/e&75,&212

5(029(5/$7$3$1,/$63$57(6'(17521287,/,=$'$6

//$0$581$3(5621$&8$/,),&$'$

(VWHDSDUDWRQRHVLPSHUPHDEOH3DUDHYLWDUHOULHVJRGHLQFHQGLR\

GHGHVFDUJDVHOpFWULFDVQRSRQJDQLQJ~QUHFLSLHQWHOOHQRGHOtTXLGR

FRPRSXHGDVHUXQYDVRRXQÀRUHURFHUFDGHODSDUDWRQLORH[SRQJD

DJRWHRVDOSLFDGXUDVOOXYLDRKXPHGDG

3DUDHYLWDUHOSHOLJURGHLQFHQGLRQRSRQJDQDGDFRQIXHJRHQFHQGLGR

FRPRSXHGDVHUXQDYHODHQFLPDGHODSDUDWR

1RXWLOLFHQLJXDUGHSLODVH[SXHVWDVGLUHFWDPHQWHDODOX]GHOVRORHQ

XELFDFLRQHVFRQGHPDVLDGRFDORUFRPRHOLQWHULRUGHXQFRFKHRFHUFD

GHXQFDOHQWDGRU(VWRSRGUtDSURYRFDUTXHODVSLODVWXYLHUDQSpUGLGDV

VHVREUHFDOHQWDUDQH[SORWDUDQRVHSUHQGLHUDQ7DPELpQSXHGHUHGXFLU

ODYLGDRUHQGLPLHQWRGHODVPLVPDV

*XDUGHODVSLH]DVSHTXHxDVIXHUDGHODOFDQFHGHORVQLxRV6LODV

LQJLULHUDQDFFLGHQWDOPHQWHSyQJDVHGHLQPHGLDWRHQFRQWDFWRFRQXQ

PpGLFR

/DVUDQXUDV\DEHUWXUDVGHODFDMDGHODSDUDWRVLUYHQSDUDVXYHQWLODFLyQ

SDUDSRGHUDVHJXUDUXQIXQFLRQDPLHQWR¿DEOHGHODSDUDWR\SDUD

SURWHJHUORFRQWUDVREUHFDOHQWDPLHQWR3DUDHYLWDUHOSHOLJURGHLQFHQGLR

ODVDEHUWXUDVQXQFDGHEHUiQWDSDUVHQLFXEULUVHFRQQDGDFRPRSRU

HMHPSORSHULyGLFRVPDQWHOHVFRUWLQDVQLSRQHUVHHQIXQFLRQDPLHQWR

HODSDUDWRVREUHXQDDOIRPEUDJUXHVDVRXQDFDPD

5LHVJRGHH[SORVLyQVLODEDWHUtDVHFDPELDSRURWUDGHXQWLSR

LQFRUUHFWR5LHVJRGHH[SORVLyQVLVHWLUDODEDWHUtDDOIXHJRRVHFRORFD

HQXQKRUQRFDOLHQWHRVLVHPDFKDFDRFRUWDPHFiQLFDPHQWH

3UHFDXFLRQHV

6LLQVWDODHODSDUDWRHQXQDLQVWDODFLyQHPSRWUDGDFRPRHQXQD

HVWDQWHUtDRHQXQDOLEUHUtDDVHJ~UHVHGHTXHHVWpELHQYHQWLODGR

'HMHFPGHHVSDFLROLEUHSRUHQFLPD\SRUORVODGRV\FPHQOD

SDUWHSRVWHULRU(OERUGHSRVWHULRUGHOHVWDQWHRHOWDEOHURGHHQFLPDGHO

DSDUDWRGHEHUtDHVWDUDXQRVFPGHOSDQHOSRVWHULRURGHODSDUHGGH

IRUPDTXHGHMHXQHVSDFLROLEUHSDUDTXHHODLUHFDOLHQWHSXHGDFLUFXODU

(QWRUQRGHIXQFLRQDPLHQWR

7HPSHUDWXUD\KXPHGDGGHOHQWRUQRGHIXQFLRQDPLHQWR&D&

)D)PHQRVGHOGHKXPHGDGUHODWLYDUHMLOODVGH

UHIULJHUDFLyQQRREVWUXLGDV

1RLQVWDOHHVWHDSDUDWRHQXQOXJDUPDOYHQWLODGRQLHQOXJDUHVH[SXHVWRV

DDOWDKXPHGDGRDODOX]GLUHFWDGHOVRORGHRWUDOX]DUWL¿FLDOSRWHQWH

$YLVRLPSRUWDQWH

(OQ~PHURGHPRGHOR\VHULHGHHVWHHTXLSRVHLQGLFDQHQVXSDUWH

SRVWHULRURLQIHULRU$SXQWHHVWRVQ~PHURVHQODWDUMHWDGHJDUDQWtD

DGMXQWD\JXiUGHODHQXQOXJDUVHJXURSDUDIXWXUDVFRQVXOWDV

35(&$8&,Ï1

(OLQWHUUXSWRUGHDOLPHQWDFLyQGHODXQLGDGQRGHVFRQHFWD

FRPSOHWDPHQWHODDOLPHQWDFLyQSURFHGHQWHGHODWRPDGHFRUULHQWH&$

3XHVWRTXHHOFDEOHGHDOLPHQWDFLyQKDFHODVIXQFLRQHVGHGLVSRVLWLYR

GHGHVFRQH[LyQGHODFRUULHQWHSDUDHODSDUDWRSDUDGHVFRQHFWDUWRGD

ODDOLPHQWDFLyQGHODSDUDWRGHEHUiGHVHQFKXIDUHOFDEOHGHODWRPD

GHFRUULHQWHGH&$3RUORWDQWRDVHJ~UHVHGHLQVWDODUHODSDUDWRGH

PRGRTXHHOFDEOHGHDOLPHQWDFLyQSXHGDGHVHQFKXIDUVHFRQIDFLOLGDG

GHODWRPDGHFRUULHQWHGH&$HQFDVRGHXQDFFLGHQWH3DUDHYLWDU

FRUUHUHOSHOLJURGHLQFHQGLRHOFDEOHGHDOLPHQWDFLyQWDPELpQGHEHUi

GHVHQFKXIDUVHGHODWRPDGHFRUULHQWHGH&$FXDQGRQRVHWHQJDOD

LQWHQFLyQGHXWLOL]DUORGXUDQWHPXFKRWLHPSRVHJXLGRSRUHMHPSOR

DQWHVGHLUVHGHYDFDFLRQHV

(VWHSURGXFWRHVSDUDWDUHDVGRPpVWLFDVJHQHUDOHV&XDOTXLHUDDYHUtD

GHELGDDRWUDXWLOL]DFLyQTXHWDUHDVGRPpVWLFDVWDOHVFRPRHOXVRD

ODUJRSOD]RSDUDPRWLYRVGHQHJRFLRVHQXQUHVWDXUDQWHRHOXVRHQ

XQFRFKHRXQEDUFR\TXHQHFHVLWDXQDUHSDUDFLyQKDUiTXHFREUDUOD

LQFOXVRGXUDQWHHOSHUtRGRGHJDUDQWtD

3UHFDXFLyQHQUHODFLyQFRQHOFDEOHHOpFWULFR

0DQLSXOHHOFDEOHHOpFWULFRSRUHOFRQHFWRU1RGHVFRQHFWHHOFRQHFWRU

WLUDQGRGHOFDEOH\QRWRTXHQXQFDHOFDEOHGHDOLPHQWDFLyQFRQODV

PDQRVPRMDGDV\DTXHHVWRSRGUtDSURYRFDUXQFRUWRFLUFXLWRRHO

ULHVJRGHHOHFWURFXFLyQ1RFRORTXHODXQLGDGPXHEOHVHWFVREUHHO

FDEOHGHDOLPHQWDFLyQ\HYLWHTXHVHSHOOL]TXH1RKDJDQXQFDQXGRV

HQHOFDEOHQLORDWHDRWURVFDEOHV(OUHFRUULGRGHORVFDEOHVHOpFWULFRV

GHEHHYLWDUODSRVLELOLGDGGHTXHVHSLVHQ8QFDEOHGHDOLPHQWDFLyQ

GHWHULRUDGRSXHGHSURYRFDUXQLQFHQGLRRHOULHVJRGHHOHFWURFXFLyQ

&RPSUXHEHHOHVWDGRGHOFDEOHGHDOLPHQWDFLyQGHYH]HQFXDQGR

6LYHTXHHVWiGHWHULRUDGRVROLFLWHDVXGLVWULEXLGRURDOFHQWURGH

UHSDUDFLyQDXWRUL]DGRPiVFHUFDQRTXHORFDPELH

35(&$8&,Ï1

(VWHDSDUDWRHVXQSURGXFWRGHOiVHUGHFODVHFODVL¿FDGRFRPRWDOHQ

6HJXULGDGGHSURGXFWRVGHOiVHU,(&

PRODUCTO LASER CLASE 1

,QIRUPDFLyQSDUDORVXVXDULRVHQODUHFRJLGD\

WUDWDPLHQWRGHORVHTXLSRVDO¿QDOGHVXYLGD\GH

ODVSLODV\EDWHUtDVXVDGDV

Símbolo para

pilas y baterías

Símbolo para

equipos

(VWRVVtPERORVHQORVSURGXFWRVHPEDODMH\RHQORVGRFXPHQWRV

TXHORVDFRPSDxDQVLJQL¿FDTXHORVSURGXFWRVHOpFWULFRV\

HOHFWUyQLFRVDO¿QDOGHVXYLGDODVSLODV\EDWHUtDVQRGHEHQ

PH]FODUVHFRQORVUHVLGXRVJHQHUDOHVGHVXKRJDU

3DUDHOWUDWDPLHQWRDGHFXDGRUHFXSHUDFLyQ\UHFLFODGRGHORV

SURGXFWRVYLHMRV\ODVSLODVXVDGDVSRUIDYRUGHSRVtWHORVHQORV

SXQWRVGHUHFRJLGDGHDFXHUGRFRQVXOHJLVODFLyQQDFLRQDO

0HGLDQWHHOWUDWDPLHQWRFRUUHFWDPHQWHGHHVWRVSURGXFWRV\

SLODVD\XGDUiDSUHVHUYDUORVUHFXUVRV\SUHYHQLUFXDOTXLHUHIHFWR

QHJDWLYRHQODVDOXGKXPDQD\HOPHGLRDPELHQWHTXHSRGUtD

VXUJLUSRUXQDLQDGHFXDGDPDQLSXODFLyQGHORVGHVSHUGLFLRV

3DUDPiVLQIRUPDFLyQVREUHUHFRJLGD\UHFLFODGRGHORVSURGXFWRV

YLHMRVSLODV\EDWHUtDVSRUIDYRUFRQWDFWHFRQVXPXQLFLSLRVREUH

ORFDOL]DFLyQGHORVSXQWRVOLPSLRVRGLUtMDVHDOSXQWRGHYHQWD

GRQGHFRPSUyORVSURGXFWRV

(VWRVVtPERORVVyORVRQYiOLGRVHQOD8QLyQ(XURSHD

3DUDSDtVHVIXHUDGHOD8QLyQHXURSHD

6LGHVHDHOLPLQDUHVWRVDUWtFXORVSRUIDYRUFRQWDFWDUFRQODV

DXWRULGDGHVORFDOHVRHOGLVWULEXLGRU\SLGDSRUHOPpWRGRFRUUHFWR

GHWUDWDPLHQWR

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Qué se encuentra en la caja

1. Unidad principal (1)

2. Mando a distancia (RC-980C) (1), Pilas (AAA/R03) (2)

3. Cable de audio analógico (Para funcionamiento de prueba) (1)

4. Cable de alimentación (1)

• Manual de instrucciones (este documento) (1)

• El cable de alimentación no debe conectarse hasta que no se hayan completado todas

las otras conexiones.

• No aceptamos ninguna responsabilidad por daño causado debido a la conexión de

equipos fabricados por otras compañías.

• Las especificaciones y las características están sujetas a cambios sin previo aviso.

La alimentación principal no se puede conectar o desconectar a través del mando a

distancia. Utilice el botón 8 STANDBY/ON de la unidad principal.

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Panel frontal

Nombres de las piezas

1. Botón/indicador 8 STANDBY/ON: Enciende y apaga la alimentación principal de la

unidad. Cuando se encienda la unidad, el indicador del centro del botón se iluminará en

azul.

2. Indicador STANDBY: Se ilumina en rojo cuando la unidad está en modo de espera.

3. Bandeja del disco: Colocar aquí los discos. También pueden utilizarse discos de 8 cm.

4. Botón ; : Abrir o cerrar la bandeja de discos.

5. Botones de reproducción:

u t : Volver a inicio de la pista que se está reproduciendo. Pulse de nuevo para

pasar a la pista anterior. Manténgalo pulsado para rebobinar la pista rápidamente.

/h : Reproducir o pausar la reproducción.

y i : Cuando se pulsa durante la reproducción, pasa a la siguiente pista. Manténgalo

pulsado para avanzar rápido a través de la pista.

: Este botón detiene la reproducción.

6. Sensor del mando a distancia

• El rango de recepción del mando a distancia está a una distancia aproximada de

16´/5 m y a un ángulo de 20° en dirección vertical y 30° de derecha a izquierda.

7. Botón/indicador CD/SACD: Cambia entre CD/SACD como fuente. Cuando reproduzca un

SACD híbrido, la capa que se está reproduciendo cambia si lo pulsa durante la

reproducción. (P18)

El indicador se ilumina en azul cuando se selecciona SACD.

8. Botón/indicador DIRECT: Activa y desactiva el modo DIRECT. (P15)

El indicador se ilumina en azul cuando el modo DIRECT está en ON.

9. Pantalla (P7)

10.

Botón SOURCE: Cambia la fuente a reproducir.

11.

Botón SETUP: Muestra el menú SETUP. (P16)

6bkbl87 9

14352

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Panel trasero

1. Conector ANALOG OUT: Utilice un cable de audio analógico para conectar un

amplificador integrado, por ejemplo.

2. AC IN: Conecte el cable de alimentación suministrado.

3. Puerto USB DAC: Utilice un cable USB (tipo A-B) para conectar un ordenador.

4. Conector DIGITAL OUT OPTICAL/COAXIAL: Utilice un cable óptico digital o un cable

coaxial digital para conectar un amplificador integrado, por ejemplo.

5. Conector CONTROL IN/OUT: Si conecta amplificadores y dispositivos de audio de la

marca Pioneer, puede centralizar el control. Por ejemplo, puede controlar los

amplificadores y los dispositivos de audio.

345

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Mando a distancia

1. Botón ^ STANDBY/ON: Cuando la alimentación principal

de la unidad está encendida, este botón enciende la

unidad o la pone en modo de espera. La alimentación

principal no se puede conectar o desconectar a través

del mando a distancia.

2. Botón SHUFFLE: Ajuste la reproducción aleatoria.

(P13)

3. Botón REPEAT: Ajuste la reproducción repetida. (P13)

4. Botones numerados: Utilícelos para introducir

directamente el número de pista de un CD de música

cuando se seleccionan pistas. También se utilizan para

introducir números de pista para la reproducción de

programa.

5. Botón CLEAR: Borra el contenido establecido para la

reproducción de programa. (P13)

6. Botón DIGITAL FILTER: Seleccione uno de los tres tipos

de DIGITAL FILTER. (P15)

7. Cursores, botón ENTER: Seleccione el elemento con los

cursores y pulse ENTER para confirmar.

8. Botón SETUP: Muestra el menú SETUP. (P16)

9. Botones de reproducción:

u : Volver a inicio de la pista que se está

reproduciendo. Pulse de nuevo para pasar a la pista

anterior.

/h : Reproducir o pausar la reproducción.

i : Pasar a la siguiente pista.

t : Manténgalo pulsado para rebobinar rápidamente la

pista que se está reproduciendo.

g : Detener la reproducción.

y : Manténgalo pulsado para hacer avanzar

rápidamente la pista que se está reproduciendo.

10.

Botón SOURCE: Cambia la fuente a reproducir.

11.

Botón DIRECT: Activa y desactiva el modo DIRECT.

(P15)

12.

Botón DISPLAY: Cambia la información en la pantalla.

• Dependiendo de la fuente, puede que la operación no

se inicie.

13.

Botón ; OPEN/CLOSE: Abrir o cerrar la bandeja de

discos.

14.

Botón PROGRAM: Se utiliza para la reproducción

programada. (P13)

15.

Botón LOCK RANGE: Muestra la pantalla de

configuración LOCK RANGE ADJUST. (P15)

16.

Botón RETURN: Regresa la pantalla al estado anterior.

17.

Botón UP SAMPLING: Cambie la función UP SAMPLING

ON y OFF. (P15)

18.

Botón CD/SACD: Cambia entre CD/SACD como fuente.

Cuando reproduzca un SACD híbrido, la capa que se

está reproduciendo cambia si lo pulsa durante la

reproducción. (P18)

19.

Botón DIGITAL OUT: Activa y desactiva la salida digital.

(P16)

20.

Botón DISPLAY OFF: Púlselo para apagar la pantalla de

la unidad. Pulse de nuevo para encender la pantalla.

21.

Botón DIMMER: Puede ajustar el brillo de la pantalla en

tres pasos. (Valor predeterminado: Nivel 3)

bl bt

bm ck

Haga coincidir la

polaridad cuando

inserte las pilas.

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Pantalla

1. Se ilumina durante la reproducción de SACD y DSD.

2. Visualización de mensajes: Muestra información sobre las pistas y los menús.

3. Se ilumina cuando es posible realizar operaciones con los cursores del mando a

distancia.

4. Muestra el estado de reproducción.

5. Se ilumina cuando el ajuste de salida de audio digital está activado. (P16)

6. Se ilumina cuando se muestran elementos como el tiempo restante de una pista o del

disco o el tiempo total del disco.

7. Mostrar al reproducir un archivo o secuencia MQA. Para más información, consulte

"Reproducir MQA". (P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Conexiones con un amplificador

Instalació n

Reproduzca el audio de los discos reproducidos en esta

unidad y de los dispositivos conectados a esta unidad a

través de sistemas de altavoces conectados a los

amplificadores integrados o receptores AV. Establezca la

conexión para adecuar los conectores de entrada de su

amplificador.

Conexión con un cable de audio analógico

La señal se convierte en analógica en el convertidor D/A de

la unidad y después se transmite a un amplificador

integrado, por ejemplo. Conecte los conectores LINE IN de

un amplificador integrado al conector ANALOG OUT

(conector RCA) de la unidad.

Esta unidad

Amplificador integrado, receptor de AV, etc.

a Cable de audio analógico

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Conexión con un cable óptico digital

La señal se convierte en analógica en el convertidor D/A del

amplificador integrado, por ejemplo. Conecte el conector

OPTICAL IN de un amplificador integrado al conector

DIGITAL OUT OPTICAL de la unidad.

• El audio de SACD y DSD o la entrada de USB DAC no

se emite desde el conector DIGITAL OUT OPTICAL de

esta unidad.

• Las señales digitales que esta unidad puede transmitir

son señales PCM lineales con una frecuencia de

muestreo y una tasa de bits de cuantificación de

192 kHz/24 bit (puede que no sea posible el

funcionamiento con todos los dispositivos conectados o

entornos).

Conexión con un cable coaxial digital

La señal se convierte en analógica en el convertidor D/A del

amplificador integrado, por ejemplo. Conecte el conector

COAXIAL IN de un amplificador integrado al conector

DIGITAL OUT COAXIAL de la unidad.

• El audio de SACD y DSD o la entrada desde USB DAC

no se emite desde el conector DIGITAL OUT COAXIAL

de esta unidad.

• Las señales digitales que esta unidad puede transmitir

son señales PCM lineales con una frecuencia de

muestreo y una tasa de bits de cuantificación de

192 kHz/24 bit (puede que no sea posible el

funcionamiento con todos los dispositivos conectados o

entornos).

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

El conector de control

Si posee múltiples dispositivos de la marca Pioneer, y estos

tienen conectores CONTROL IN/OUT, puede controlarlos

de manera centralizada a través del sensor del mando a

distancia del amplificador, por ejemplo. Si se conectan

cables mini plug monoaurales (sin resistencias) como se

muestra en el diagrama, entonces incluso aunque esta

unidad y otros dispositivos estén colocados en ubicaciones

en las que no puedan recibir la señal del mando a distancia,

aún puede utilizar el mando a distancia para controlar esta

unidad u otros dispositivos apuntando el mando a distancia

al sensor del mando a distancia del amplificador, por

ejemplo.

• Asegúrese también de que establece la conexión con el

cable de audio analógico. El control centralizado no

puede funcionar correctamente únicamente con la

conexión del conector de control.

• El sensor del mando a distancia de esta unidad deja de

funcionar si conecta un cable mini plug monoaural (sin

resistencia) al conector CONTROL IN de esta unidad.

• Los sensores del mando a distancia que se encuentran

en otros dispositivos dejan de funcionar si conecta un

cable mini plug monoaural (sin resistencia) al conector

CONTROL OUT de esta unidad.

• Si un reproductor de red y un amplificador de marca

Pioneer se conectan a través del conector CONTROL IN/

OUT, puede realizar operaciones básicas en esta

unidad, el reproductor de red y el amplificador mediante

una aplicación de teléfono inteligente a través de una

red.

(Un ejemplo de conexión)

CONTROL

OUT

CONTROL

OUT

Esta unidad

Amplificador

Dispositivo de

audio

a Cables mini plug monoaurales (sin resistencias)

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Conexión del cable de alimentación, etc.

1 2

Conexión del cable de alimentación

Este modelo incluye un cable de alimentación extraíble.

El cable de alimentación debe conectarse sólo después de

que todas las otras conexiones se hayan completado.

Conecte el cable de alimentación al terminal AC IN de la

unidad en primer lugar y luego conéctelo a la toma.

Desconecte siempre el cable de alimentación del lado de la

toma de corriente primero cuando desconecte el cable de

alimentación.

Puesta en marcha

Pulse 8 STANDBY/ON en la unidad principal.

• Al encender, pulse hasta que el botón se quede pulsado.

Cuando se encienda la unidad, el indicador

8 STANDBY/ON del centro del botón se iluminará en

azul.

a Cable de alimentación

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Reproducción de discos

Reproduc ción

Consulte (P18) para información sobre los discos que

puede reproducir en esta unidad.

Reproducción de CDs de música

Realice el siguiente procedimiento cuando la unidad esté encendida.

1. Pulse CD/SACD en el mando a distancia para establecer

la fuente en CD/SACD.

2. Pulse ; en la unidad principal para abrir la bandeja del

disco, después de poner el disco en la bandeja, pulse de

nuevo ; para cerrar la bandeja.

3. Pulse /h (g) en el mando a distancia para iniciar la

reproducción.

4. Utilice los botones de reproducción (h) para detener la

reproducción o elegir las pistas que desea reproducir.

También puede seleccionar introduciendo el número de

pista con los botones numéricos (b). Cuando introduzca un

número de pista de 2 dígitos, pulse el botón +10 tantas

veces como el valor del segundo dígito (decenas), después

pulse el valor del primer dígito. Si pulsa DISPLAY (d), puede

cambiar la pantalla para que muestre el tiempo transcurrido

o el tiempo restante del disco, etc.

• El contenido mostrado depende del disco.

Reproducción de un disco con archivos de música

Realice el siguiente procedimiento cuando la unidad esté

encendida.

1. Pulse CD/SACD en el mando a distancia para establecer

la fuente en CD/SACD.

2. Pulse ; en la unidad principal para abrir la bandeja del

disco, después de poner el disco en la bandeja, pulse de

nuevo ; para cerrar la bandeja.

3. Pulse /h (g) en el mando a distancia para iniciar la

reproducción.

4. Utilice los botones de reproducción (h) para detener la

reproducción o elegir las pistas que desea reproducir. Si pulsa

DISPLAY (d), puede cambiar la visualización para que muestre

el tiempo transcurrido o el tiempo restante del disco, el nombre

de archivo de la pista o el nombre de la pista, etc.

• El contenido mostrado depende del disco y el archivo.

• La visualización del nombre de pista es compatible

solo con archivos de música en formato MP3/WMA/

FLAC/AAC (M4A solo)/DSD (DSF solo).

• Los caracteres que no se puedan mostrar en esta

unidad aparecerán como "".

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Reproducción repetida

1. Pulse repetidamente REPEAT (a) durante la

reproducción para visualizar o en la pantalla.

: Reproducción repetida de todas las pistas.

: Reproducción repetida de la pista que se está

reproduciendo.

Para cancelar repetir reproducción, pulse REPEAT (a)

varias veces hasta visualizar en la pantalla.

Reproducción aleatoria

1. Pulse SHUFFLE (f) durante la reproducción o detención

para mostrar en la pantalla.

: Reproducción de todas las pistas aleatoriamente.

Para cancelar la reproducción aleatoria, pulse SHUFFLE

(f) hasta visualizar en la pantalla.

Reproducción de programa

Puede seleccionar el orden en que se reproducen las pistas

de un CD de música.

1. Pulse PROGRAM (e) mientras está detenido.

"P00" se muestra cuando no se ha registrado nada.

Introduzca el número de pista que quiere registrar con los

botones numéricos (b). Cuando introduzca un número de

pista de 2 dígitos, pulse el botón +10 tantas veces como el

valor del segundo dígito (decenas), después pulse el valor

del primer dígito. El número en "P00" aumenta cada vez

que registra una pista. Se pueden registrar hasta 24 pistas.

• Para reproducir el programa registrado, pulse /h (g)

en el mando a distancia.

• Si pulsa CLEAR (c) mientras se registran pistas, las

pistas se borran en orden, empezando por la última

que registró.

• Si pulsa PROGRAM (e) mientras se registran pistas,

todas las pistas que haya registrado se borrarán.

• Si el tiempo de reproducción total del programa registrado

excede de 99 minutos y 59 segundos, "



" se

visualiza en la pantalla.

ALL 1

ALL

OFF

Especificaciones de los archivos que pueden reproducirse

* Cuando se reproduzcan archivos que excedan los 48 kHz, utilice archivos que hayan sido grabados en un disco DVD.

Notas acerca de todos los tipos de archivos

• Utilice discos CD/CD-R/CD-RW que cumplan con el estándar de sistema de archivos de CD-ROM nivel 1/nivel 2

ISO9660 y que estén grabados usando el sistema que cumpla con el formateo extendido (Joliet y Romeo). Cuando se

usan discos DVD, además de lo mencionado anteriormente, utilice discos grabados usando el sistema de archivos UDF.

• La estructura de carpetas está limitada a ocho niveles y el número máximo de pistas es 3000. Sin embargo, dependiendo

de la estructura de carpetas, puede que no se reconozcan y reproduzcan todas las carpetas y pistas.

Notas acerca de tipos específicos de archivos

• Codifique los archivos WMA utilizando aplicaciones certificadas por Microsoft Corportation de los Estados Unidos. Puede

que el funcionamiento no sea correcto si utiliza aplicaciones no certificadas.

• Esta unidad es compatible con la reproducción de archivos AAC con la extensión ".m4a" que hayan sido codificados

usando iTunes. Sin embargo, la reproducción no será posible si el archivo ha sido protegido con protección de copia

DRM (protección de copyright) o con algunas versiones de iTunes utilizadas para la codificación.

• Los archivos WAV incluyen audio digital PCM sin comprimir.

• Los archivos AIFF incluyen audio digital PCM sin comprimir.

Velocidades de

muestreo

Velocidades de

bits

Bit de

cuantificación

Tipos de discos que pueden reproducirse

Extensión

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44,1/48 kHz

Entre 8 kbps y

320 kbps y VBR.

–.mp3

WMA 44,1/48 kHz

Entre 5 kbps y

192 kbps y VBR.

–.wma

AAC 44,1/48/88,2/96 kHz

Entre 8 kbps y

320 kbps y VBR.

–

.aac/

.m4a

WAV

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.wav

AIFF

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.aif/

.aiff

FLAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.flac

ALAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.m4a

DSD 2,8/5,6 MHz – 1 bit –

.dsf/

.dff

MQA

44,1/48/88,2/96/176,4/

192/352,8/384 kHz

– 8/16/24 bit

.flac/

.wav

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Usar esta unidad como convertidor D/A

Se puede convertir el audio digital del PC a analógico en

esta unidad y, a continuación, emitirlo desde los conectores

ANALOG OUT.

Cambiar de fuente

1. Pulse SOURCE en esta unidad o en el mando a

distancia para cambiar la fuente de esta unidad a "USB

DAC".

Conexiones

2. Utilice un cable USB de tipo A-B para conectar un

ordenador.

Reproducción

3. Inicie la reproducción en el reproductor.

• Las señales digitales que esta unidad puede introducir

son señales PCM lineales con una frecuencia de

muestreo y una tasa de bits de cuantificación de 48 kHz/

32 bit (puede que no sea posible el funcionamiento con

todos los dispositivos conectados o entornos).

• SO compatibles del PC a conectar con Windows10

Mac OS X.

• Si se trata de otros SO diferentes a los compatibles, el

sonido puede interrrumpirse o no emitirse.

• Dependiendo del entorno de uso, la reproducción puede

no realizarse normalmente

USB DAC

a Cable USB

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Ajuste de la calidad de sonido

Reproducción fiel del sonido original

(modo DIRECT)

El procesamiento que afecta a la calidad del sonido se

desactivará para reproducir un sonido más cercano al

original.

(Valor predeterminado): OFF

1. Pulse DIRECT (d).

• El indicador DIRECT de la parte delantera de la unidad

principal se ilumina cuando el modo DIRECT está en

ON.

• Cuando el modo DIRECT está en ON, DIGITAL OUT se

cambia a OFF.

• En modo DIRECT, la pantalla se apaga automáticamente

al reproducir un CD o SACD o conectar un USB DAC.

• Al cambiar de configuración durante la reproducción, el

audio puede interrumpirse.

DIGITAL FILTER

Seleccione uno de los tres tipos de DIGITAL FILTER.

1. La configuración cambia cada vez que pulsa DIGITAL

FILTER (a).

"SLOW": Sonido suave y fluido

"SHARP" (Valor predeterminado): Sonido con mayor

estructura y firmeza

"SHORT": Sonido que comienza rápido y parece que se

mueva hacia adelante

• También puede pulsar SETUP (c) para visualizar la

pantalla de configuración DIGITAL FILTER desde el

menú SETUP. En ese caso, seleccione el valor de ajuste

con / (b) en el mando a distancia.

• La configuración se establece en "SHORT" al reproducir

MQA-CD o un disco que contenga archivos de música o

utilizando USB DAC.

• Al cambiar de configuración durante la reproducción, el

audio puede interrumpirse.

UP SAMPLING

Aumentar la frecuencia de muestreo ayuda a conseguir una

reproducción de sonido con un grado de claridad más alto.

(Valor predeterminado) : OFF

1. También se puede pulsar UP SAMPLING (g) para ON y

OFF la función.

• Esta función no se puede utilizar cuando el modo

DIRECT está configurado en ON o durante la

reproducción de SACD o DSD.

• La configuración se establece en "ON" al reproducir

MQA-CD o un disco que contenga archivos de música o

utilizando USB DAC.

• Al cambiar de configuración durante la reproducción, el

audio puede interrumpirse.

Ajuste del rango de bloqueo

(LOCK RANGE ADJUST)

La calidad de sonido se mejora reduciendo el rango de

bloqueo para reducir los sonidos incidentales. Sin embargo,

reducir el rango de bloqueo demasiado puede provocar

interrupciones en el sonido y ruido. Ajuste el rango de

bloqueo mientras escucha algún audio.

(Valor predeterminado): RANGE 6

1. Pulse LOCK RANGE (e).

2. Seleccione el valor de ajuste con / (f) en el mando a

distancia.

"RANGE 6" (amplio) a "RANGE 1" (reducido)

• También puede pulsar SETUP (c) para visualizar la

pantalla de configuración LOCK RANGE ADJUST desde

el menú SETUP.

• La configuración se establece en "6" al reproducir

MQA-CD o un disco que contenga archivos de música o

utilizando USB DAC.

• LOCK RANGE ADJUST no tiene efecto en el audio de

SACD y DSD.

• Al cambiar de configuración durante la reproducción, el

audio puede interrumpirse.

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada |Otros

Configuración avanzada

La unidad le permite configurar ajustes avanzados para

brindarle una experiencia todavía mejor.

1. Pulse SETUP en el mando a distancia.

2. Seleccione el contenido o el ajuste con los cursores del

mando a distancia y pulse ENTER para confirmar su

selección. Para volver a la pantalla anterior, pulse

RETURN.

3. Para salir de los ajustes, pulse SETUP.

AUTO STANDBY

Este ajuste pone la unidad en modo de espera

automáticamente después de 20 minutos de inactividad sin

ningún tipo de entrada de audio.

"ON" (Valor predeterminado): La unidad pasará

automáticamente al modo de espera.

"OFF": La unidad no pasará automáticamente al modo de

espera.

POWER ON PLAY

Puede ajustarlo de modo que el disco empiece a

reproducirse automáticamente cuando se encienda la

unidad.

• Usando un temporizador automático conectado

externamente, puede usar la reproducción con

temporizador cuando se enciende automáticamente la

alimentación.

"ON": Para reproducir discos automáticamente

"OFF" (Valor predeterminado): Cuando no se van a

reproducir discos

DIGITAL OUT

Realice los ajustes de la salida de audio digital. Cuando no

se conecte al conector DIGITAL OUT OPTICAL/COAXIAL,

puede escuchar un audio aún más claro ajustando esto en

OFF.

"ON" (Valor predeterminado), "OFF"

DIGITAL FILTER

Puede seleccionar el tipo de DIGITAL FILTER. (P15)

UP SAMPLING

Aumentar la frecuencia de muestreo ayuda a conseguir una

reproducción de sonido con un grado de claridad más alto.

(P15)

LOCK RANGE ADJUST

Ajuste del rango de bloqueo. (P15)

LOADING MODE

El tiempo de carga para CD se puede reducir.

• Al activar esta función, el tiempo de carga se reduce

dependiendo del CD. Sin embargo, se pueden producir

saltos al principio de la reproducción.

"NORMAL" (Valor predeterminado): El tiempo de carga

para CD no se reduce

"FAST": El tiempo de carga para CD se reduce

AUTO STANDBY

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Resolución de problemas

Otros

Antes de iniciar el procedimiento

Cuando el funcionamiento es inestable, se pueden resolver

los problemas simplemente encendiendo la unidad o

poniéndola en modo de espera o desconectando y

volviendo a conectar el cable de alimentación, en vez de

revisar los ajustes y operaciones. Intente las medidas

simples tanto en la unidad como en el dispositivo

conectado. Si el problema no se soluciona después de

consultar "Resolución de problemas", el problema podría

solucionarse restaurando la unidad al estado en el que se

encontraba en el momento de envío.

Restauración de la unidad (esto restaura la

configuración predeterminada de fábrica)

1. Con la unidad encendida y ningún disco insertado,

mientras mantiene pulsado g en la unidad principal,

pulse DIRECT.

2. Se visualizará "CLEAR", la unidad pasará al modo de

espera y los ajustes se reiniciarán.

■ Alimentación

No se puede conectar la unidad

• Desconecte el cable de alimentación de la toma de

corriente, espere 2 minutos o más y conéctelo

nuevamente.

La unidad se apaga inesperadamente

• La unidad pasa automáticamente al modo de espera

cuando funciona el ajuste "AUTO STANDBY" en el menú

de configuración SETUP.

El indicador STANDBY de la unidad principal continúa

parpadeando en rojo y no es posible realizar operaciones.

• Desconecte el cable de alimentación de la toma de

corriente, espere 2 minutos o más y conéctelo nuevamente.

El indicador continuará parpadeando, pero pulse

STANDBY/ON en la unidad principal para encender la

alimentación principal ajustándola en ON. Si esto no

resuelve el problema, puede que se haya producido un mal

funcionamiento. Desconecte el cable de alimentación de la

toma de corriente y póngase en contacto con el distribuidor

o con nuestro servicio de soporte técnico.

■ La pantalla no se ilumina

• Puede que la pantalla se haya apagado al pulsar DISPLAY

OFF. Pulse DISPLAY OFF para encender la pantalla.

■ No se pueden reproducir discos

• Coloque el disco en la bandeja de discos con el lado

etiquetado hacia arriba.

• Puede que la reproducción no sea posible si el disco

está rayado o sucio.

• Los archivos de sonido que están protegidos por las

leyes de derechos de autor no se pueden reproducir.

• La bandeja del disco se abre si inserta un disco que no

sea compatible con esta unidad.

■ Audio

El sonido se interrumpe

• Reducir el rango de bloqueo demasiado con el ajuste

LOCK RANGE ADJUST puede provocar interrupciones

en el sonido y también puede causar ruido. Las

interrupciones de sonido causadas por ajustes en el

rango de bloqueo no están cubiertas por nuestras

garantías de funcionamiento. Escuche algún audio

mientras ajusta el rango de bloqueo.

No hay sonido digital

• Establezca "DIGITAL OUT" en el menú SETUP en "ON".

• El audio de SACD y DSD o entrada desde USB DAC no

se emite digitalmente.

■ Mando a distancia

• Asegúrese de que las pilas están instaladas con la

polaridad correcta.

• Instale pilas nuevas. No mezcle distintos tipos de pilas, o

pilas nuevas con usadas.

• Asegúrese de que esta unidad no esté expuesta a la luz

solar directa o a luces fluorescentes de tipo inversión.

Reubique si es necesario.

• Si esta unidad está instalada en un estante o una vitrina con

puertas de cristal de color, o si las puertas están cerradas, el

mando a distancia podría no funcionar con precisión.

■ Función de convertidor D/A

• Asegúrese de que los dispositivos están conectados

adecuadamente.

• Reproduzca audio compatible con los conectores de

entrada de esta unidad. (P14)

No se puede reproducir audio desde ordenadores

• Cancele el modo silencioso en su ordenador.

• Seleccione esta unidad en los ajustes de salida de audio

de su ordenador. Si la fuente de esta unidad se establece

en algo que no sea “USB DAC”, el PC no puede detectar

esta unidad.

• Si se están ejecutando múltiples aplicaciones en el

ordenador, apague las aplicaciones que no esté utilizando.

La frecuencia de muestreo es siempre la misma a

través de la entrada USB DAC

• Dependiendo de los ajustes del ordenador, incluso aunque

las frecuencias de muestreo de los archivos que se están

reproduciendo sean diferentes, estas se convierten a la

misma frecuencia de muestreo para su transmisión.

Los sonidos del ordenador que no son música se

escuchan a través de la entrada USB DAC

• Dependiendo de los ajustes del ordenador, sonidos

como el tono de inicio del ordenador o los sonidos de

error puede que se reproduzcan a través de esta unidad.

■ SACD

• Debido a las diferencias en los métodos de grabación, puede

que exista una diferencia de volumen entre SACD y CD.

CLEAR

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Otras notas

■ Discos que pueden reproducirse

Precauciones para la reproducción

• Pueden usarse los discos compactos (CDs) con el

siguiente logo en la superficie de la etiqueta.

• Tenga en cuenta que puede que algunos discos no se

reproduzcan debido a las características del disco, a

rayones, a la contaminación o al estado de grabación.

Reproducir MQA

Esta unidad incluye la tecnología MQA (Master Quality

Authenticated) que permite la reproducción de archivos y

transmisiones de audio MQA, ofreciendo el mismo sonido

que la grabación maestra original.

Esta unidad es un reproductor de CD que puede reconocer

un MQA-CD. El descodificador integrado MQA restablecerá

y confirmará la señal de alta resolución que se emite en el

estudio con la firma de autenticación.

Visite www.mqa.co.uk/customer/mqacd para obtener más

información.

‘MQA’ o ‘MQA.’ indica que el producto está descodificando

y reproduciendo una secuencia o archivo MQA e indica la

procedencia para garantizar que el sonido es idéntico al

material de la fuente. ‘MQA.’ indica que está reproduciendo

un archivo MQA Studio, que ha sido autorizado en el

estudio por el artista/productor o verificado por el

propietario del copyright.

Reproducción de SACD híbrido

El SACD híbrido consiste en dos capas; la capa SACD y la

capa CD. Pulse CD/SACD para seleccionar la capa que

desee escuchar.

Reproducción de DualDisks

Un "DualDisk" es un disco con vídeo y audio que cumple el

estándar DVD por una cara y contiene audio que puede

reproducirse en un reproductor de CD en la otra.

En la cara de audio que no es la cara de DVD, puede que la

reproducción no sea siempre posible debido a que el disco no

cumple con las especificaciones físicas de los CD estándar.

Operaciones durante la reproducción

La búsqueda directa no funciona mientras se reproducen

discos con datos de música.

Tipos de discos que no pueden reproducirse en

esta unidad

DVD Video, DVD Audio, CD-G, Video CD, DTS-CD

Notas sobre los discos

• Tenga cuidado de no pillarse la mano o los dedos

cuando abra o cierre la bandeja de discos.

• Nunca use discos con formas inusuales (como

corazones u octógonos). Este tipo de discos podría

atascarse y dañar la unidad.

• Algunos CDs de audio con control de copia no cumplen

los estándares de CD oficiales. Se trata de discos

especiales y no pueden reproducirse en esta unidad.

• No use discos con residuos de celofán, discos alquilados

con pegatinas que se despegan o discos con etiquetas

decorativas. Estos tipos de discos podrían quedarse

pegados a la unidad o podrían dañarla.

• No deje en la unidad un disco con una etiqueta impresa

con una impresora de inyección durante un tiempo

prolongado. El disco podría quedarse pegado a la unidad

o podría dañarla.

■ Limpieza del reproductor

• Normalmente, limpie el reproductor con un paño blando.

Para eliminar la suciedad difícil de quitar, ponga un poco

de detergente neutro diluido en 5 ó 6 partes de agua en

un paño blando, escurra bien el paño, páselo por el

reproductor y, finalmente, pase un paño seco.

• El uso de alcohol, diluyente, bencina o insecticida en el

reproductor puede ser la causa de que la pintura y el

revestimiento se despeguen. Evite también dejar

productos de goma o vinilo en contacto con el reproductor

durante mucho tiempo porque se dañará la caja.

•

Cuando use paños impregnados en productos químicos,

etc., lea las instrucciones del paño cuidadosamente.

• Cuando sea difícil eliminar el polvo adherido a la bandeja

del disco, aplique una cinta adhesiva, etc. para eliminar

el polvo.

■ Precauciones al mover la unidad

Cuando mueva la unidad, retire cualquier disco y cierre la

bandeja de discos. A continuación pulse 8 STANDBY/ON

en la unidad principal, espere 10 segundos después de que

[OFF] desaparezca de la pantalla y entonces desenchufe el

cable de alimentación. Mover la unidad mientras aún hay

un disco en ella puede provocar daños.

■ Condensación

Pueden formarse gotas de agua en el interior de la unidad

si se lleva de un lugar frío a una habitación cálida o cuando

una habitación fría se calienta rápidamente con una

calefacción. A esto se le llama condensación. Esto no solo

puede provocar que la unidad funcione mal, sino que

también puede dañar el disco o partes de la unidad. Se

recomienda quitar los discos de la unidad si no se va a usar

durante un tiempo. Si existe la posibilidad de que se haya

formado condensación, desenchufe el cable de

alimentación y permita que la unidad permanezca a

temperatura ambiente durante al menos 3 horas.

MQA-CD

SACD (Super Audio CD)

(solo área de 2 canales)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Antes de empezar > Nombres de las piezas > Instalación > Reproducción

Configuración avanzada | Otros

Especificaciones generales

■ Salida de audio analógico

Nivel de salida nominal e impedancia

• RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100 

Respuesta de frecuencia

• CD: 2 Hz - 20 kHz,

SACD: 2 Hz - 50 kHz (-3 dB)

Relación señal/ruido

• CD: 116 dB o más (A-weighting),

SACD: 116 dB o más (A-weighting)

THD+N

• CD: 0,002 % o menos,

SACD: 0,002 % o menos

■ Entrada de audio digital

USB DAC

• Tipo B, USB Audio Class 1.0

■ Salida de audio digital

Salida digital coaxial

• Conector RCA, 0,5 Vp-p / 75 

Salida digital óptica

• Conector óptico, -14 - -21 dBm / 660 nm

■ Otros

Entrada de control

• Miniconector Ø3,5 (mono)

Salida de control

• Miniconector Ø3,5 (mono)

■ General

Alimentación

• 220 - 230 V CA, 50/60 Hz

Consumo de energía

•43W

• 0,3 W (en modo de espera)

AUTO STANDBY

• ON (20 min) / OFF

Dimensiones (An  Al  Pr)

• 435 mm  138 mm  413 mm

Peso

• 13,1 kg

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

SUPER AUDIO CD PLAYER

PD-50AE

Manuale di

istruzioni

Prima di iniziare

Informazioni relative alla sicurezza ......................................... 2

Contenuto della confezione .................................................... 3

Nome dei componenti

Pannello frontale ..................................................................... 4

Pannello posteriore ................................................................. 5

Telecomando .......................................................................... 6

Display .................................................................................... 7

Installazione

Collegamenti con un amplificatore ......................................... 8

Collegamento del cavo di alimentazione, ecc. ......................11

Riproduzione

Riproduzione di dischi .......................................................... 12

Utilizzo di questa unità come convertitore D/A ..................... 14

Regolazione della qualità audio ............................................ 15

Impostazioni avanzate

Impostazioni Avanzate .......................................................... 16

Altri

Risoluzione dei problemi ...................................................... 17

Altre note ............................................................................... 18

Caratteristiche generali.......................................................... 19

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Informazioni relative alla sicurezza

Prima di iniziare

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

,OVLPERORGHOIXOPLQHUDFFKLXVRLQXQWULDQJRORHTXLODWHURVHUYHDG

DYYLVDUHO¶XWLOL]]DWRUHGHOODSUHVHQ]DGL³WHQVLRQLSHULFRORVH´QRQLVRODWH

DOO¶LQWHUQRGHOULYHVWLPHQWRGHOSURGRWWRFKHSRVVRQRHVVHUHGLLQWHQVLWj

VXႈFLHQWHGDFRVWLWXLUHXQULVFKLRGLVFRVVHHOHWWULFKHDOOHSHUVRQH

,OSXQWRHVFODPDWLYRDOO¶LQWHUQRGLXQWULDQJRORHTXLODWHUR

VHUYHDGDYYLVDUHO¶XWLOL]]DWRUHGHOODSUHVHQ]DGLLPSRUWDQWL

LVWUX]LRQLSHUO¶LPSLHJRHODPDQXWHQ]LRQHULSDUD]LRQHQHL

PDQXDOLDOOHJDWLDOSURGRWWR

$77(1=,21(

3(5(9,7$5(,/5,6&+,2',6&266((/(775,&+(1215,0829(5(,/

&23(5&+,22,/5(752121&,62123$57,,17(51(/$&8,0$187(1=,21(

3266$(66(5(())(778$7$'$//¶87(17(,1&$62',1(&(66,7¬

5,92/*(56,(6&/86,9$0(17($3(5621$/(',6(59,=,248$/,),&$72

$77(1=,21(

3(5(9,7$5(,/5,6&+,2',6&266((/(775,&+(121

5,0829(5(,/&23(5&+,22,/5(752121&,6212

3$57,,17(51(/$&8,0$187(1=,21(3266$(66(5(

())(778$7$'$//¶87(17(,1&$62',1(&(66,7¬5,92/*(56,

(6&/86,9$0(17($3(5621$/(',6(59,=,248$/,),&$72

4XHVWRDSSDUHFFKLRQRQqLPSHUPHDELOH3HUSUHYHQLUHSHULFROLGL

LQFHQGLRIROJRUD]LRQLQRQSRVL]LRQDUHQHOOHYLFLQDQ]HGLTXHVWR

DSSDUHFFKLRFRQWHQLWRULSLHQLGLOLTXLGLTXDOLYDVLGD¿RULRVLPLOLHQRQ

HVSRUUHO¶DSSDUHFFKLRDVJRFFLROLLVFKL]]LSLRJJLDRXPLGLWj

3HUHYLWDUHLOSHULFRORGLLQFHQGLQRQSRVL]LRQDUHVXOO¶DSSDUHFFKLR

GLVSRVLWLYLFRQ¿DPPHYLYHDGHVHPSLRXQDFDQGHODDFFHVDRVLPLOL

1RQXVDUHQpFRQVHUYDUHOHEDWWHULHDOODOXFHGLUHWWDGHOVROHRLQ

OXRJKLHFFHVVLYDPHQWHFDOGLDGHVHPSLRDOO¶LQWHUQRGLXQ¶DXWRPRELOH

RLQSURVVLPLWjGLXQFDORULIHUR/HEDWWHULHSRWUHEEHURSHUGHUHOLTXLGR

VXUULVFDOGDUVLHVSORGHUHRSUHQGHUHIXRFR$QFKHODGXUDWDHOH

SUHVWD]LRQLGHOOHEDWWHULHSRWUHEEHURULVXOWDUHULGRWWH

&RQVHUYDUHLSLFFROLULFDPELIXRULGDOODSRUWDWDGHLEDPELQLHGHLEHEp

6HLQJKLRWWLWLDFFLGHQWDOPHQWHUHFDUVLLPPHGLDWHPHQWHGDOPHGLFR

/¶DSSDUHFFKLRqGRWDWRGLXQFHUWRQXPHURGLIHVVXUHHGLDSHUWXUHSHU

ODYHQWLOD]LRQHDOORVFRSRGLJDUDQWLUQHXQIXQ]LRQDPHQWRDႈGDELOHH

SHUSURWHJJHUORGDOVXUULVFDOGDPHQWR3HUSUHYHQLUHSRVVLELOLSHULFROLGL

LQFHQGLOHDSHUWXUHQRQGHYRQRPDLYHQLUHEORFFDWHRFRSHUWHFRQRJJHWWL

YDULTXDOLJLRUQDOLWRYDJOLHWHQGHRWHQGDJJLHFFHO¶DSSDUHFFKLRQRQ

GHYHHVVHUHXWLOL]]DWRDSSRJJLDQGRORVXWDSSHWLVSHVVLRVXOOHWWR

3HULFRORGLHVSORVLRQHVHODEDWWHULDYLHQHVRVWLWXLWDFRQXQDGLWLSRQRQ

FRUUHWWR5LVFKLRGLHVSORVLRQHVHODEDWWHULDYLHQHVPDOWLWDLQ¿DPPHR

IRUQLRVHYLHQHPHFFDQLFDPHQWHVFKLDFFLDWDRWDJOLDWD

3UHFDX]LRQL

6HVLLQVWDOODO¶DSSDUHFFKLRDOO¶LQWHUQRGLXQPRELOHFRPHDGHVHPSLR

XQDOLEUHULDRXQRVFDႇDOHDVVLFXUDUVLFKHFLVLDXQ¶DGHJXDWD

YHQWLOD]LRQH

/DVFLDUHXQRVSD]LROLEHURGLFPVRSUDHDLODWLGHOO¶DSSDUHFFKLRH

FPVXOUHWUR,OODWRSRVWHULRUHGHOORVFDႇDOHRLOULSLDQRVRSUD

O¶DSSDUHFFKLRGHYRQRHVVHUHUHJRODWLDFPGLGLVWDQ]DGDOSDQQHOOR

SRVWHULRUHRGDOPXURFUHDQGRXQ¶DSHUWXUDSHUODIXRULXVFLWDGHOO¶DULDFDOGD

&RQGL]LRQLDPELHQWDOLGLIXQ]LRQDPHQWR

*DPPDLGHDOHGHOODWHPSHUDWXUDHGXPLGLWjGHOO¶DPELHQWHGL

IXQ]LRQDPHQWRGD&D&GD)D)XPLGLWjUHODWLYD

LQIHULRUHDOOµIHVVXUHGLYHQWLOD]LRQHQRQEORFFDWH

1RQLQVWDOODUHO¶DSSDUHFFKLRLQOXRJKLSRFRYHQWLODWLRLQOXRJKLHVSRVWL

DGDOWHXPLGLWjRDOODGLUHWWDOXFHGHOVROHRDVRUJHQWLGLOXFHDUWL¿FLDOH

PROWRIRUWL

$YYLVRLPSRUWDQWH

,OQXPHURGHOPRGHOORHGLOQXPHURGLVHULHGLTXHVWDDSSDUHFFKLDWXUD

VLWURYDQRVXOUHWURRVXOIRQGR$QQRWDUHTXHVWLQXPHULVXOODVFKHGDGL

JDUDQ]LDDOOHJDWDHFRQVHUYDUHLQXQOXRJRVLFXURSHUULIHULPHQWRIXWXUR

$99(57(1=$

,OSXOVDQWHGLDFFHQVLRQHVXTXHVWDXQLWjQRQGLVWDFFDFRPSOHWDPHQWH

ODFRUUHQWHSURYHQLHQWHGDOODSUHVD&$'DOPRPHQWRFKHLOFDYRGL

DOLPHQWD]LRQHFRVWLWXLVFHO¶XQLFRGLVSRVLWLYRGLGLVWDFFRGHOO¶DSSDUHFFKLR

GDOODVRUJHQWHGLDOLPHQWD]LRQHLOFDYRVWHVVRGHYHHVVHUHVWDFFDWR

GDOODSUHVDGLFRUUHQWHDOWHUQDWDGLUHWHSHUVRVSHQGHUHFRPSOHWDPHQWH

TXDOVLDVLÀXVVRGLFRUUHQWH9HUL¿FDUHTXLQGLFKHO¶DSSDUHFFKLRVLD

VWDWRLQVWDOODWRLQPRGRGDSRWHUSURFHGHUHFRQIDFLOLWjDOGLVWDFFRGHO

FDYRGLDOLPHQWD]LRQHGDOODSUHVDGLFRUUHQWHLQFDVRGLQHFHVVLWj

3HUSUHYHQLUHSHULFROLGLLQFHQGLLQROWUHLOFDYRGLDOLPHQWD]LRQHGHYH

HVVHUHVWDFFDWRGDOODSUHVDGLFRUUHQWHDOWHUQDWDGLUHWHVHVLSHQVDGL

QRQXWLOL]]DUHO¶DSSDUHFFKLRSHUSHULRGLGLWHPSRUHODWLYDPHQWHOXQJKLDG

HVHPSLRGXUDQWHXQDYDFDQ]D

4XHVWRSURGRWWRqGHVWLQDWRHVFOXVLYDPHQWHDOO¶XVRGRPHVWLFR

(YHQWXDOLGLVIXQ]LRQLGRYXWHDGXVLGLYHUVLTXDOLXVRSUROXQJDWRDVFRSL

FRPPHUFLDOLLQULVWRUDQWLRXVRLQDXWRRVXQDYLHFKHULFKLHGDQR

SDUWLFRODULULSDUD]LRQLVDUDQQRDFDULFRGHOO¶XWHQWHDQFKHVHQHOFRUVR

GHOSHULRGRGLJDUDQ]LD

$YYHUWHQ]DUHODWLYDDOFDYRHOHWWULFR

$ႇHUUDUHLOFDYRGLDOLPHQWD]LRQHGDOODVSLQD1RQVWDFFDUHODVSLQD

WLUDQGRLOFDYRHQRQWRFFDUHPDLLOFDYRHOHWWULFRFRQOHPDQLEDJQDWHLQ

TXDQWRTXHVWRSRWUHEEHFDXVDUHXQFRUWRFLUFXLWRRXQDVFRVVDHOHWWULFD

1RQSRVL]LRQDUHO¶XQLWjXQPRELOHHFFVXOFDYRHOHWWULFRRSL]]LFDUH

LOFDYR1RQIDUHPDLXQQRGRQHOFDYRROHJDUORFRQDOWULFDYL,FDYL

HOHWWULFLGHYRQRHVVHUHLQVWUDGDWLLQPRGRWDOHFKHQRQVLDSRVVLELOH

FDOSHVWDUOL8QFDYRHOHWWULFRGDQQHJJLDWRSXzFDXVDUHXQLQFHQGLR

RXQDVFRVVDHOHWWULFD&RQWUROODUHSHULRGLFDPHQWHLOFDYRHOHWWULFR

4XDQGRVLULOHYDFKHqGDQQHJJLDWRULFKLHGHUQHXQRVRVWLWXWLYRDOQRVWUR

FHQWURGLDVVLVWHQ]DDXWRUL]]DWRSLYLFLQRRDOSURSULRULYHQGLWRUH

$99(57(1=$

4XHVWRDSSDUHFFKLRqXQSURGRWWRDOODVHUGL&ODVVHVHFRQGROH

QRUPHGLVLFXUH]]DGHLSURGRWWLDOODVHU,(&

PRODOTTO LASER DI CLASSE 1

,QIRUPD]LRQLSHUJOLXWLOL]]DWRUL¿QDOLVXOODUDFFROWD

HORVPDOWLPHQWRGLYHFFKLGLVSRVLWLYLHEDWWHULH

HVDXVWH

Simbolo per

il prodotto

Esempi di simboli

per le batterie

4XHVWLVLPEROLVXLSURGRWWLFRQIH]LRQLHRGRFXPHQWLDOOHJDWL

VLJQL¿FDQRFKHYHFFKLSURGRWWLHOHWWULFLHGHOHWWURQLFLHEDWWHULH

HVDXVWHQRQGHYRQRHVVHUHPLVFKLDWLDLUL¿XWLXUEDQLLQGLႇHUHQ]LDWL

3HUO¶DSSURSULDWRWUDWWDPHQWRUHFXSHURHULFLFODJJLRGLYHFFKL

SURGRWWLHEDWWHULHHVDXVWHIDWHULIHULPHQWRDLSXQWLGLUDFFROWD

DXWRUL]]DWLLQFRQIRUPLWjDOODYRVWUDOHJLVOD]LRQHQD]LRQDOH

&RQLOFRUUHWWRVPDOWLPHQWRGLTXHVWLSURGRWWLHGHOOHEDWWHULH

DLXWHUDLDVDOYDJXDUGDUHSUH]LRVHULVRUVHHSUHYHQLUHLSRWHQ]LDOL

HႇHWWLQHJDWLYLVXOO¶DPELHQWHHVXOODVDOXWHXPDQDFKHDOWULPHQWL

SRWUHEEHURVRUJHUHGDXQDLQDSSURSULDWDJHVWLRQHGHLUL¿XWL

3HUPDJJLRULLQIRUPD]LRQLVXOODUDFFROWDHLOULFLFODJJLRGLYHFFKL

SURGRWWLHEDWWHULHHVDXVWHFRQWDWWDWHLOYRVWUR&RPXQHLO6HUYL]LR

GLUDFFROWDRLOSXQWRYHQGLWDGRYHDYHWHDFTXLVWDWRO¶DUWLFROR

4XHVWLVLPEROLVRQRYDOLGLVRORQHOO¶8QLRQH(XURSHD

3HULSDHVLDOGLIXRULGHOO¶XQLRQH(XURSHD

6HYROHWHOLEHUDUYLTXHVWLRJJHWWLFRQWDWWDWHOHYRVWUHDXWRULWjORFDOL

RLOSXQWRYHQGLWDSHULOFRUUHWWRPHWRGRGLVPDOWLPHQWR

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Contenuto della confezione

1. Unità principale (1)

2. Telecomando (RC-980C) (1), Batterie (AAA/R03) (2)

3. Cavo audio analogico (per operazioni di test) (1)

4. Cavo di alimentazione (1)

• Manuale di istruzioni (questo documento) (1)

• Il cavo di alimentazione deve essere collegato solo dopo che sono stati completati tutti gli

altri collegamenti.

• Non accetteremo responsabilità per danni derivanti dal collegamento di apparecchiature

prodotte da altre aziende.

• Le specifiche tecniche e l’aspetto sono soggetti a variazioni senza preavviso.

Non è possibile accendere o spegnere l'unità con il telecomando. Usare il tasto

8 STANDBY/ON sull'unità principale.

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Pannello frontale

Nome dei componenti

1. Pulsante/indicatore 8 STANDBY/ON: Consente di accendere/spegnere l'unità. All'avvio

dell'unità, l'indicatore posto al centro del pulsante si accende in blu.

2. Indicatore STANDBY: È rosso fisso quanto l'unità è in modalità standby.

3. Piatto portadisco: Posizionare i dischi qui. Possono essere utilizzati anche dischi da 8 cm.

4. Pulsante ; : Apre o chiude il piatto portadisco.

5. Tasti di riproduzione:

u t : Torna all'inizio del brano in riproduzione. Premere nuovamente per passare al

brano precedente. Tenere premuto per riavvolgere il brano velocemente.

/h : Avvia o mette in pausa la riproduzione.

y i : Quando viene premuto durante la riproduzione, passa al brano successivo.

Tenere premuto per mandare avanti il brano velocemente.

: Questo tasto arresta la riproduzione.

6. Sensore del telecomando

• Il campo di ricezione del telecomando è entro una distanza di circa 16'/5 m, con un

angolo di 20° in direzione verticale e di 30° a destra e sinistra.

7. Pulsante/indicatore CD/SACD: Consente di scegliere tra CD e SACD come sorgente.

Premendo questo pulsante durante la riproduzione di un disco SACD ibrido, viene

modificato il layer in riproduzione. (P18)

L'indicatore si accende in blu quando viene selezionato SACD.

8. Pulsante/indicatore DIRECT: Consente di attivare e disattivare la modalità DIRECT.

(P15)

L'indicatore si accende in blu quando la modalità DIRECT è attiva.

9. Display (P7)

10.

Pulsante SOURCE: Seleziona la sorgente da riprodurre.

11.

Pulsante SETUP: Consente di visualizzare il menu SETUP. (P16)

6bkbl87 9

14352

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Pannello posteriore

1. Jack ANALOG OUT: Utilizza un cavo audio analogico per collegare, ad esempio, un

amplificatore integrato.

2. AC IN: Consente di collegare il cavo di alimentazione in dotazione.

3. Porta USB DAC: Utilizzare un cavo USB (di tipo A-B) per collegare un computer.

4. Jack DIGITAL OUT OPTICAL/COAXIAL: Utilizzare un cavo digitale ottico o un cavo

digitale coassiale per collegare, ad esempio, un amplificatore integrato.

5. Jack CONTROL IN/OUT: Quando si collegano amplificatori e dispositivi audio Pioneer è

possibile il controllo centralizzato. Per esempio, è possibile controllare gli amplificatori e i

dispositivi audio.

345

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Telecomando

1. Tasto ^ STANDBY/ON: Quando l'unità è alimentata,

consente di accendere l'unità o di passare alla modalità

standby. Non è possibile accendere o spegnere l'unità

con il telecomando.

2. Pulsante SHUFFLE: Impostare la ripetizione casuale.

(P13)

3. Pulsante REPEAT: Consente di impostare la

riproduzione ripetuta. (P13)

4. Tasti numerati: Possono essere utilizzati per immettere

direttamente il numero del brano di un CD musicale

durante la selezione dei brani. Possono essere utilizzati

inoltre per immettere i numeri dei brani per la

riproduzione programmata.

5. Pulsante CLEAR: Consente di eliminare il contenuto

impostato per la riproduzione programmata. (P13)

6. Pulsante DIGITAL FILTER: Consente di selezionate uno

dei tre tipi di DIGITAL FILTER. (P15)

7. Cursori, tasto ENTER: Selezionare la voce con i cursori e

premere ENTER per confermare.

8. Pulsante SETUP: Consente di visualizzare il menu

SETUP. (P16)

9. Tasti di riproduzione:

u : Torna all'inizio del brano in riproduzione. Premere

nuovamente per passare al brano precedente.

/h : Avvia/mette in pausa la riproduzione.

i : Passa al brano successivo.

t : Tenere premuto per riavvolgere velocemente il

brano in riproduzione.

g : Arresta la riproduzione.

y : Tenere premuto per mandare avanti velocemente il

brano in riproduzione.

10.

Pulsante SOURCE: Seleziona la sorgente da riprodurre.

11.

Pulsante DIRECT: Consente di attivare/disattivare la

modalità DIRECT. (P15)

12.

Pulsante DISPLAY: Consente di cambiare le informazioni

sul display.

• A seconda della sorgente, l'operazione potrebbe non

essere avviata.

13.

Pulsante ; OPEN/CLOSE: Apre o chiude il piatto

portadisco.

14.

Pulsante PROGRAM: Da usare per programmare la

riproduzione. (P13)

15.

Pulsante LOCK RANGE: Consente di visualizzare la

schermata delle impostazioni LOCK RANGE ADJUST.

(P15)

16.

Pulsante RETURN: Riporta il display allo stato

precedente.

17.

Tasto UP SAMPLING: Consente di impostare la funzione

UP SAMPLING su ON e OFF. (P15)

18.

Pulsante CD/SACD: Consente di scegliere tra CD e

SACD come sorgente. Premendo questo pulsante

durante la riproduzione di un disco SACD ibrido, viene

modificato il layer in riproduzione. (P18)

19.

Pulsante DIGITAL OUT: Consente di attivare e

disattivare l'uscita digitale. (P16)

20.

Pulsante DISPLAY OFF: Premere per spegnere il display

di questa unità. Premere nuovamente per accendere il

display.

21.Pulsante DIMMER: È possibile regolare la luminosità del

display su tre livelli. (Valore predefinito: Livello 3)

bl bt

bm ck

Rispettare la polarità

quando si inseriscono le

batterie.

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Display

1. Si accende durante la riproduzione di SACD e DSD.

2. Visualizzazione messaggi: Mostra le informazioni sui brani e sui menu.

3. Si accende quando è possibile effettuare operazioni tramite i tasti cursore del

telecomando.

4. Mostra lo stato di riproduzione.

5. Si accende quando l'impostazione dell'uscita audio digitale è attiva. (P16)

6. Si accende quando vengono mostrati elementi quali il tempo residuo di un brano o del

disco oppure la durata totale del disco.

7. Appare quando viene riprodotto un file o streaming MQA. Per informazioni dettagliate,

consultare il paragrafo "Riproduzione MQA". (P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Collegamenti con un amplificatore

Installazione

Riprodurre l'audio da dischi riprodotti su questa unità e da

dispositivi collegati a questa unità attraverso diffusori

collegati ad amplificatori integrati o ricevitori AV. Eseguire il

collegamento in modo idoneo ai terminali di ingresso

dell'amplificatore.

Collegamento con un cavo audio analogico

Il segnale viene convertito in analogico dal convertitore D/A

di questa unità e poi inviato, ad esempio, a un amplificatore

integrato. Collegare i terminali LINE IN di un amplificatore

integrato al terminale ANALOG OUT (RCA) di questa unità.

Questa unità

Amplificatore integrato, ricevitore AV, ecc.

a Cavo audio analogico

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Collegamento con un cavo digitale ottico

Il segnale viene convertito in analogico dal convertitore D/A

dell'amplificatore integrato, ad esempio. Collegare il

terminale OPTICAL IN di un amplificatore integrato al

terminale DIGITAL OUT OPTICAL di questa unità.

• L’audio di SACD e DSD o l’ingresso da USB DAC non

viene emesso dal jack DIGITAL OUT OPTICAL di questa

unità.

• I segnali digitali che possono essere emessi da questa

unità sono segnali lineari PCM con frequenza di

campionamento e bit rate di quantizzazione di 192 kHz/

24 bit (il funzionamento potrebbe non essere possibile

con tutti i dispositivi collegati o in tutti gli ambienti).

Collegamento con un cavo digitale

coassiale

Il segnale viene convertito in analogico dal convertitore D/A

dell'amplificatore integrato, ad esempio. Collegare il

terminale COAXIAL IN di un amplificatore integrato al

terminale DIGITAL OUT COAXIAL di questa unità.

• L’audio di SACD e DSD o l’ingresso da USB DAC non

viene emesso dal jack DIGITAL OUT COAXIAL di questa

unità.

• I segnali digitali che possono essere emessi da questa

unità sono segnali lineari PCM con frequenza di

campionamento e bit rate di quantizzazione di 192 kHz/

24 bit (il funzionamento potrebbe non essere possibile

con tutti i dispositivi collegati o in tutti gli ambienti).

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Terminale di controllo

Se si possiedono diversi dispositivi Pioneer dotati di

terminali CONTROL IN/OUT, è possibile controllarli tutti a

livello centrale attraverso il sensore del telecomando

sull'amplificatore, ad esempio. Effettuando il collegamento

attraverso cavi minijack mono (senza resistori) come

mostrato nell'immagine, anche se questa unità e altri

dispositivi vengono posizionati in punti dai quali non sia

possibile ricevere il segnale del telecomando, sarà

comunque possibile usare il telecomando per controllare

questa unità o altri dispositivi puntando il telecomando

verso il relativo sensore sull'amplificatore, ad esempio.

• Accertarsi anche di eseguire il collegamento con il cavo

audio analogico. La sola connessione del terminale di

controllo non è sufficiente per il funzionamento corretto

del controllo centralizzato.

• Il sensore del telecomando su questa unità smette di

funzionare se si collega un cavo minijack mono (senza

resistore) al terminale CONTROL IN di questa unità.

• I sensori del telecomando sugli altri dispositivi smettono

di funzionare se si collega un cavo minijack mono (senza

resistore) al terminale CONTROL OUT di questa unità.

• Se si effettua il collegamento di un lettore di rete e un

amplificatore Pioneer attraverso il terminale CONTROL

IN/OUT, è possibile eseguire operazioni di base su

questa unità, sul lettore di rete e sull'amplificatore tramite

un'app per smartphone usando la rete.

(esempio di collegamento)

CONTROL

OUT

CONTROL

OUT

Questa unità

Amplificatore

Dispositivo

audio

a Cavi minijack mono (senza resistori)

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Collegamento del cavo di alimentazione, ecc.

1 2

Collegamento del cavo di alimentazione

Questo modello include un cavo di alimentazione estraibile.

Il cavo di alimentazione deve essere collegato solo dopo

che sono stati completati tutti gli altri collegamenti.

Accertarsi che il cavo di alimentazione sia collegato al

terminale AC IN dell’unità, poi collegarlo alla presa.

Scollegare sempre prima il lato presa e successivamente il

cavo di alimentazione.

Avvio

Premere 8 STANDBY/ON sull'unità principale.

• All'avvio, premere fino a far rientrare il pulsante. All'avvio

dell'unità, l'indicatore 8 STANDBY/ON posto al centro

del pulsante si accende in blu.

a Cavo di alimentazione

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Riproduzione di dischi

Riproduz ione

Per indicazioni sui dischi che possono essere riprodotti su

questa unità, fare riferimento a (P18).

Riproduzione di CD musicali

Eseguire la procedura sotto descritta quando l'unità è accesa.

1. Premere CD/SACD sul telecomando per impostare la

sorgente su CD/SACD.

2. Premere ; sull'unità principale per aprire il vassoio del

disco, e dopo aver messo il disco sul vassoio, premere

nuovamente ;.

3. Premere /h (g) sul telecomando per avviare la

riproduzione.

4. Usare i tasti di riproduzione (h) per arrestare la riproduzione

o scegliere i brani da riprodurre. È possibile selezionare

anche immettendo il numero del brano usando i tasti

numerici (b). Quando si immette il numero di un brano con

2 cifre, premere il tasto +10 per un numero di volte

corrispondente al valore della seconda cifra (decine), quindi

premere il valore della prima cifra. Premendo DISPLAY (d),

è possibile alternare la visualizzazione in modo da vedere il

tempo trascorso o il tempo rimanente del disco, ecc.

• Il contenuto visualizzato dipende dal disco.

Riproduzione di un disco contenente file

musicali

Eseguire la procedura sotto descritta quando l'unità è accesa.

1. Premere CD/SACD sul telecomando per impostare la

sorgente su CD/SACD.

2. Premere ; sull'unità principale per aprire il vassoio del

disco, e dopo aver messo il disco sul vassoio, premere

nuovamente ;.

3. Premere



(g) sul telecomando per avviare la riproduzione.

4. Usare i tasti di riproduzione (h) per arrestare la riproduzione

o scegliere i brani da riprodurre. Premendo DISPLAY (d), è

possibile alternare la visualizzazione in modo da vedere il

tempo trascorso o il tempo rimanente del disco, il nome del

file del brano o il nome del brano, ecc.

• Il contenuto visualizzato dipende dal disco e dal file.

• La visualizzazione del nome del brano è supportata

solamente con i file musicali in formato MP3/WMA/

FLAC/AAC (solo M4A)/DSD (solo DSF).

• I caratteri che non possono essere visualizzati da

questa unità appaiono come "".

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Riproduzione ripetuta

1. Premere ripetutamente REPEAT (a) durante la

riproduzione per visualizzare o sul display.

: riproduzione ripetuta di tutti i brani.

: riproduce ripetutamente il brano in esecuzione.

Per annullare la riproduzione ripetuta, premere REPEAT

(a) diverse volte fino a visualizzare sul display.

Ripetizione casuale

1. Premere SHUFFLE (f) durante la riproduzione o

arrestarla per visualizzare sul display.

: riproduce tutti brani in ordine casuale.

Per annullare la riproduzione casuale, premere SHUFFLE

(f) fino a visualizzare sul display.

Ripetizione programmata

È possibile impostare l'ordine di riproduzione dei brani di un

CD musicale.

1. Premere PROGRAM (e) quando non è in corso alcuna

riproduzione.

Se non è stato registrato nulla, viene visualizzato "P00".

Immettere il numero del brano che si desidera registrate

servendosi dei tasti numerici (b). Quando si immette il

numero di un brano con 2 cifre, premere il tasto +10 per

un numero di volte corrispondente al valore della seconda

cifra (decine), quindi premere il valore della prima cifra. Il

numero in "P00" aumenta ogni volta che si registra un

brano. È possibile registrare fino a 24 brani.

• Per riprodurre la programmazione registrata, premere

/h (g) sul telecomando.

• Premendo CLEAR (c) durante la registrazione dei

brani, i brani vengono eliminati in ordine a partire

dall'ultimo brano registrato.

• Premendo PROGRAM (e) durante la registrazione dei

brani, vengono eliminati tutti i brani registrati.

• Se la durata di riproduzione totale del programma

registrato è superiore a 99 minuti e 59 secondi, sul

display viene visualizzato " : ".

ALL 1

ALL

OFF

Specifiche dei file che possono essere riprodotti

* Quando si riproducono file oltre i 48 kHz, usare file registrati su un DVD.

Note riguardanti tutti i tipi di file

• Usare dischi CD/CD-R/CD-RW conformi alla ISO9660 Livello 1/Livello 2 che definisce il tipo di file system per supporti

CD-ROM registrati con un sistema conforme alla formattazione estesa (Joliet e Romeo). Quando si utilizzano dischi DVD,

in aggiunta a quanto indicato sopra, usare dischi registrati con file system UDF.

• La struttura delle cartelle è limitata a otto livelli e il numero massimo di brani è 3000. Tuttavia, a seconda della struttura

delle cartelle, è possibile che non tutte le cartelle e non tutti i brani vengano riconosciuti e riprodotti.

Note riguardanti tipi specifici di file

• Codificare i file WMA mediante applicazioni certificate dalla statunitense Microsoft Corporation. Se si utilizzano

applicazioni non certificate, potrebbero verificarsi errori di funzionamento.

• Questa unità supporta la riproduzione di file AAC con estensione ".m4a" codificati con iTunes. Tale riproduzione potrebbe

tuttavia non essere possibile nel caso in cui il file sia protetto mediante sistema di protezione da copia DRM (tutela dei

diritti d'autore) o altre versioni di iTunes usate per la codifica.

• I file WAV includono audio digitale PCM non compresso.

• I file AIFF includono audio digitale PCM non compresso.

Frequenze di

campionamento

Bitrate

Bit di

quantizzazione

Tipi di dischi che possono essere riprodotti

Estensione

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44,1/48 kHz

Tra 8 kbps e

320 kbps e VBR.

–.mp3

WMA 44,1/48 kHz

Tra 5 kbps e

192 kbps e VBR.

–.wma

AAC 44,1/48/88,2/96 kHz

Tra 8 kbps e

320 kbps e VBR.

–

.aac/

.m4a

WAV

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.wav

AIFF

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.aif/

.aiff

FLAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.flac

ALAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.m4a

DSD 2,8/5,6 MHz – 1 bit –

.dsf/

.dff

MQA

44,1/48/88,2/96/176,4/

192/352,8/384 kHz

– 8/16/24 bit

.flac/

.wav

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Utilizzo di questa unità come convertitore D/A

Su questa unità è possibile convertire l’audio digitale del PC

in analogico ed emetterlo dai jack ANALOG OUT.

Commutazione della sorgente

1. Premere SOURCE su questa unità oppure sul

telecomando per far passare la sorgente dell’unità a

"USB DAC".

Connessioni

2. Utilizzare un cavo USB di tipo A-B per effettuare il

collegamento al computer.

Riproduzione

3. Avviare la riproduzione sul lettore.

• I segnali digitali in ingresso che possono essere

ammessi da questa unità sono segnali lineari PCM con

frequenza di campionamento e bit rate di quantizzazione

di 48 kHz/32 bit (il funzionamento potrebbe non essere

possibile con tutti i dispositivi collegati o in tutti gli

ambienti).

• SO supportati del PC da collegare sono Windows10

Mac OS X.

• Con SO diversi da quelli supportati, il suono potrebbe

interrompersi o non essere riprodotto.

• A seconda dell’ambiente di utilizzo, la riproduzione

potrebbe non funzionare correttamente.

USB DAC

a Cavo USB

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Regolazione della qualità audio

Riproduzione fedele del suono originale

(modalità DIRECT)

Le elaborazioni che influenzano la qualità audio vengono

disattivate, quindi viene riprodotto un suono più vicino

all'originale.

(Valore predefinito): OFF

1. Premere DIRECT (d).

• L'indicatore DIRECT sulla parte anteriore dell'unità

principale si illumina quando la modalità DIRECT è ON.

• Quando la modalità DIRECT è ON, DIGITAL OUT è

impostato su OFF.

• In modalità DIRECT, il display si spegne

automaticamente durante la riproduzione di CD o SACD,

o quando si collega USB DAC.

• Se si modifica l’impostazione durante la riproduzione,

l’audio potrebbe interrompersi.

DIGITAL FILTER

Consente di selezionate uno dei tre tipi di DIGITAL FILTER.

1. L'impostazione cambia ogni volta che si preme DIGITAL

FILTER (a).

"SLOW": suono morbido e fluido

"SHARP" (Valore predefinito): suono con maggiore

struttura e carattere più deciso

"SHORT": suono con una sensazione di avvio rapido e di

avanzamento

• È anche possibile premere SETUP (c) per visualizzare la

schermata di impostazione DIGITAL FILTER dal menu

SETUP. In questo caso, selezionare il valore di

impostazione con / (b) sul telecomando.

• L’impostazione è fissa su "SHORT" durante la

riproduzione di MQA-CD o di un disco contente file

musicali, o quando si utilizza USB DAC.

• Se si modifica l’impostazione durante la riproduzione,

l’audio potrebbe interrompersi.

UP SAMPLING

L'aumento della frequenza di campionamento aiuta a

ottenere una riproduzione del suono con un livello di

chiarezza maggiore.

(Valore predefinito) : OFF

1. È inoltre possibile premere anche UP SAMPLING (g) per

impostare questa funzione su ON e OFF.

• Non è possibile utilizzare questa funzionalità quando la

modalità DIRECT è impostata su ON o durante la

riproduzione di SACD o DSD.

• L’impostazione è fissa su "ON" durante la riproduzione di

MQA-CD o di un disco contente file musicali, o quando si

utilizza USB DAC.

• Se si modifica l’impostazione durante la riproduzione,

l’audio potrebbe interrompersi.

Regolazione del range di blocco

(LOCK RANGE ADJUST)

La qualità audio viene migliorata restringendo il range di

blocco per ridurre i suoni incidentali. Tuttavia, un eccessivo

restringimento del range di blocco può causare interruzioni

del suono e rumore. Regolare il range di blocco durante

l'ascolto.

(Valore predefinito): RANGE 6

1. Premere LOCK RANGE (e).

2. Selezionare il valore dell'impostazione con / (f) sul

telecomando.

Da "RANGE 6" (ampio) a "RANGE 1" (ristretto)

• È anche possibile premere SETUP (c) per visualizzare la

schermata di impostazione LOCK RANGE ADJUST dal

menu SETUP.

• L’impostazione è fissa su "6" durante la riproduzione di

MQA-CD o di un disco contente file musicali, o quando si

utilizza USB DAC.

• LOCK RANGE ADJUST non ha alcun effetto sull'audio di

SACD e DSD.

• Se si modifica l’impostazione durante la riproduzione,

l’audio potrebbe interrompersi.

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate |Altri

Impostazioni Avanzate

Impostazioni avanzate

Questa unità consente di configurare le impostazioni

avanzate in modo da fornire un'esperienza ancora migliore.

1. Premere SETUP sul telecomando.

2. Selezionare il contenuto o l'impostazione con i cursori sul

telecomando, quindi premere ENTER per confermare la

selezione. Per tornare alla schermata precedente,

premere RETURN.

3. Per uscire dalle impostazioni, premere SETUP.

AUTO STANDBY

Questa impostazione mette automaticamente l'unità in

standby dopo 20 minuti di inattività senza alcun ingresso

audio.

"ON" (Valore predefinito): L’unità entrerà automaticamente

in modalità standby.

"OFF": L’unità non entrerà automaticamente in standby.

POWER ON PLAY

È possibile definire l'impostazione in modo che la

riproduzione del disco venga avviata automaticamente

all'accensione di questa unità.

• Utilizzando un timer automatico collegato esternamente,

è possibile impostare la riproduzione con timer

all'attivazione automatica dell'alimentazione.

"ON": Per riprodurre i dischi automaticamente

"OFF" (Valore predefinito): Per non riprodurre i dischi

DIGITAL OUT

Effettuare le impostazioni dell'uscita audio digitale. Se non

si effettua il collegamento al terminale DIGITAL OUT

OPTICAL/COAXIAL, è possibile godere di un audio ancora

più nitido impostando questa opzione su OFF.

"ON" (Valore predefinito), "OFF"

DIGITAL FILTER

È possibile selezionare il tipo di DIGITAL FILTER. (P15)

UP SAMPLING

L'aumento della frequenza di campionamento aiuta a

ottenere una riproduzione del suono con un livello di

chiarezza maggiore. (P15)

LOCK RANGE ADJUST

Regolazione del range di blocco. (P15)

LOADING MODE

È possibile abbreviare i tempi di caricamento per i CD.

• L’attivazione di questa funzionalità consente di

abbreviare i tempi di caricamento a seconda del CD,

tuttavia il suono potrebbe risultare intermittente all’inizio

della riproduzione.

"NORMAL" (Valore predefinito): Se i tempi di caricamento

per i CD non vengono abbreviati

"FAST": Se i tempi di caricamento per i CD vengono

abbreviati

AUTO STANDBY

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Risoluzione dei problemi

Altri

Prima di iniziare la procedura

In caso di funzionamento instabile, i problemi potrebbero

essere risolti semplicemente accendendo l'unità, passando

alla modalità standby o scollegando/collegando il cavo di

alimentazione, invece di intervenire su impostazioni e

procedure operative. Provare queste semplici azioni sia

sull’unità sia sul dispositivo connesso. Se, dopo aver fatto

riferimento a "Risoluzione dei problemi", il problema

persiste, il ripristino dell'unità allo stato in cui era al

momento della spedizione potrebbe risolvere il problema.

Resettare l'unità (questo resetta le impostazioni

dell'unità ai valori predefiniti)

1. Quando l'alimentazione è attiva e non è inserito alcun

disco, premere DIRECT tenendo premuto g sull'unità

principale.

2. Compare il messaggio "CLEAR", l'unità va in standby e le

impostazioni vengono resettate.

■ Alimentazione

Impossibile accendere l’unità

• Scollegare il cavo di alimentazione dalla presa di

corrente, attendere almeno 2 minuti, quindi ricollegarlo.

L’unità si spegne inaspettatamente

• L'unità va automaticamente in standby quando è

impostato "AUTO STANDBY" nel menu SETUP.

L'indicatore STANDBY sull'unità principale continua a

lampeggiare in rosso e non sono possibili altre operazioni

• Scollegare il cavo di alimentazione dalla presa di

corrente, attendere almeno 2 minuti, quindi ricollegarlo.

L'indicatore continuerà a lampeggiare, ma premere

8 STANDBY/ON sull'unità principale per attivare

l'alimentazione (ON). Se questo non risolve il problema,

potrebbe trattarsi di un malfunzionamento. Scollegare il

cavo di alimentazione dalla presa a muro e contattare il

rivenditore o la nostra assistenza clienti.

■ Il display non si illumina

• È possibile che il display sia stato spento premendo DISPLAY

OFF. Premere DISPLAY OFF per accendere il display.

■ Impossibile riprodurre dischi

• Posizionare il disco sul piatto portadisco con il lato

dell'etichetta rivolto verso l'alto.

• La riproduzione potrebbe non essere possibile in

presenza di graffi o sporco sul disco.

• I file audio che sono protetti da copyright non possono

essere riprodotti.

• Il piatto portadisco si apre nel caso in cui venga inserito

un disco non supportato da questa unità.

■ Audio

Il suono è interrotto

• Un eccessivo restringimento del range di blocco

nell'impostazione LOCK RANGE ADJUST può causare

interruzioni del suono e rumore. Le interruzioni del suono

causate dalla regolazione del range di blocco non sono

coperte dalle nostre garanzie di funzionamento.

Regolare il range di blocco durante l'ascolto.

Suono digitale assente

• Impostare "DIGITAL OUT" nel menu SETUP su "ON".

• L’audio di SACD e DSD o l’ingresso da USB DAC non

sono uscite digitali.

■ Telecomando

• Assicurarsi che le batterie siano installate con la polarità

corretta.

• Installare nuove batterie. Non mescolare tipi diversi di

batterie o batterie vecchie e nuove.

• Assicurarsi che questa unità non sia esposta a luce

solare diretta o a luci fluorescenti di tipo a invertitore.

Riposizionare, se necessario.

• Se questa unità è installata in uno scaffale o in un armadietto

con sportelli di vetro colorato o se le porte sono chiuse, il

telecomando potrebbe non funzionare in modo affidabile.

■ Funzionalità come convertitore D/A

• Assicurarsi che i dispositivi siano collegati correttamente.

• Riprodurre l'audio compatibile tramite i terminali di

ingresso di questa unità. (P14)

Impossibile riprodurre l'audio dai computer

• Disattivare il muting sul computer.

• Selezionare questa unità nelle impostazioni di uscita

audio sul computer in uso. Se la sorgente di questa unità

è impostata su un’opzione diversa da "USB DAC", il PC

non riesce a rilevare questa unità.

• Se sono presenti più applicazioni in esecuzione sul

computer, chiudere quelle che non si stanno utilizzando.

La frequenza di campionamento è sempre la stessa

attraverso l'ingresso USB DAC

• A seconda delle impostazioni del computer, le frequenze

di campionamento dei file in riproduzione, anche se

diverse, vengono convertite tutte nella stessa frequenza

di campionamento.

Attraverso l'ingresso USB DAC vengono ricevuti anche gli

altri suoni provenienti dal computer, non solo la musica

• A seconda delle impostazioni del computer, suoni quali

toni di avvio o di errore possono essere riprodotti tramite

questa unità.

■ SACD

• A causa di differenze nei metodi di registrazione,

potrebbero verificarsi differenze di volume tra SACD e CD.

CLEAR

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Altre note

■ Dischi che possono essere riprodotti

Precauzioni per la riproduzione

• È possibile usare i compact disc (CD) con il seguente

logo sull'etichetta.

• Notare che alcuni dischi potrebbero non essere riprodotti

a causa di caratteristiche del disco, graffi, sporcizia o

stato della registrazione.

Riproduzione MQA

Questa unità è dotata della tecnologia MQA (Master Quality

Authenticated) che consente la riproduzione di file audio e

streaming MQA, garantendo il suono della registrazione

originale master.

Questa unità è un lettore CD in grado di riconoscere un

MQA-CD. Il decoder MQA integrato ripristinerà il segnale ad

alta risoluzione ascoltato nello studio e lo confermerà

utilizzando la firma di autenticazione.

Visitare il sito web www.mqa.co.uk/customer/mqacd per

maggiori informazioni.

“MQA” o “MQA.” indica che il prodotto decodifica e riproduce

un file o streaming MQA, indicando la provenienza per

garantire che il suono sia identico a quello del materiale

sorgente. “MQA.” indica la riproduzione in corso di un file

MQA Studio, approvato nello studio dall’artista/produttore o

verificato dal titolare del diritto d’autore.

Riproduzione di SACD ibridi

Un disco SACD ibrido è composto da due layer: SACD e

CD. Premere CD/SACD per selezionare il layer che si

desidera ascoltare.

Riproduzione di DualDisc

"DualDisc" è un disco con video e audio conformi allo

standard DVD su un lato e audio riproducibile da un lettore

CD sull'altro.

Sul lato audio non DVD, la riproduzione potrebbe non

essere sempre possibile poiché il disco non è conforme alle

specifiche fisiche dei CD standard.

Operazioni durante la riproduzione

La ricerca diretta non è disponibile durante la riproduzione

di dischi con dati musicali.

Tipi di dischi che non possono essere riprodotti

con questa unità

DVD Video, DVD Audio, CD-G, Video CD, DTS-CD

Note sui dischi

• Fare attenzione a mani e dita durante l'apertura o la

chiusura del piatto portadisco.

• Non usare mai dischi con una forma particolare (come

cuori o ottagoni). Questi tipi di dischi potrebbero

incepparsi e danneggiare l'unità.

• Alcuni CD audio con funzioni di controllo della copia non

sono conformi agli standard ufficiali dei CD. Questi sono

dischi particolari e non possono essere riprodotti con

questa unità.

• Non usare dischi con residui di nastro adesivo, dischi

noleggiati con etichette che si staccano, o dischi con

etichette decorative. Questo tipo di disco potrebbe rimanere

incastrato nell'unità, o potrebbe danneggiare l'unità.

• Non lasciare un disco con etichetta stampata con una

stampante a getto d'inchiostro nell'unità a lungo. Il disco

potrebbe rimanere incastrato nell'unità, o potrebbe

danneggiare l'unità.

■ Pulizia del lettore

• Normalmente, usare un panno soffice e pulito. Per lo sporco

tenace, applicare del detergente neutro diluito in 5 o 6 parti

di acqua ad un panno soffice, strizzarlo bene, pulir via lo

sporco ed asciugare con un panno pulito e asciutto.

•

Tenere presente che l’alcool, il diluente, la benzina o

l’insetticida sul lettore possono far sbiadire le finiture e

cadere la vernice. Inoltre, evitare di lasciare oggetti in

gomma o vinile a contatto col lettore per lunghi periodi,

dato che questo può danneggiare le finiture del cabinet.

•

Se si usano panni trattati chimicamente o altri prodotti

simili, leggerne attentamente le istruzioni.

• Se risulta difficile eliminare la polvere accumulata sul piatto

portadisco, applicare nastro adesivo, ecc. per rimuoverla.

■

Precauzioni durante lo spostamento dell'unità

Durante lo spostamento dell'unità, estrarre il disco

eventualmente presente e chiudere il piatto portadisco.

Premere

STANDBY/ON sull'unità principale, attendere

10 secondi dopo la scomparsa del messaggio [OFF] dal display

e scollegare il cavo di alimentazione. Lo spostamento dell'unità

con un disco al proprio interno potrebbe causare danni.

■ Condensa

Gocce d'acqua possono formarsi all'interno di questa unità

se viene spostata da un luogo freddo ad una stanza calda o

quando una stanza fredda viene rapidamente riscaldata da

un calorifero. Questa viene chiamata condensa. Può

causare non solo il malfunzionamento dell'unità, ma può

anche danneggiare il disco o parti dell'unità.

Raccomandiamo di rimuovere i dischi dall'unità se non

viene usata per un pò di tempo. Se esiste la possibilità che

si sia formata condensa, scollegare il cavo di alimentazione

e lasciare l'unità per almeno 3 ore a temperatura ambiente.

MQA-CD

SACD (Super Audio CD)

(solo area a 2 canali)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Prima di iniziare > Nome dei componenti > Installazione > Riproduzione

Impostazioni avanzate | Altri

Caratteristiche generali

■ Uscita audio analogica

Livello e impedenza di uscita nominale

• RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100 

Risposta in frequenza

• CD: 2 Hz - 20 kHz,

SACD: 2 Hz - 50 kHz (-3 dB)

Rapporto segnale-rumore

• CD: 116 dB o superiore (correzione A),

SACD: 116 dB o superiore (correzione A)

THD+N

• CD: 0,002 % o meno,

SACD: 0,002 % o meno

■ Ingresso audio digitale

USB DAC

• Tipo B, classe audio USB 1.0

■ Uscita audio digitale

Uscita digitale coassiale

• Terminale RCA, 0,5 Vp-p / 75 

Uscita digitale ottica

• Terminale ottico, -14 - -21 dBm / 660 nm

■ Altri

Ingresso di controllo

• Mini-jack Ø3,5 (mono)

Uscita di controllo

• Mini-jack Ø3,5 (mono)

■ Generale

Alimentazione

• CA 220 - 230 V, 50/60 Hz

Consumo elettrico

•43W

• 0,3 W (in modalità standby)

AUTO STANDBY

• ON (20 min) / OFF

Dimensioni (L  A  P)

• 435 mm  138 mm  413 mm

Peso

• 13,1 kg

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

vDe

SUPER AUDIO CD PLAYER

PD-50AE

Bedienungsanleitung

Vor dem Start

Sicherheitshinweise ................................................................ 2

Lieferumfang ........................................................................... 3

Teilenamen

Bedienfeld ............................................................................... 4

Rückseite ................................................................................ 5

Fernbedienung ....................................................................... 6

Display .................................................................................... 7

Installation

Verbindungen mit einem Verstärker ....................................... 8

Anschließen des Netzkabels usw. .........................................11

Wiedergabe

Wiedergabe von Discs .......................................................... 12

Verwenden dieses Geräts als D/A-Wandler ......................... 14

Anpassen der Klangqualität .................................................. 15

Erweiterte Einrichtung

Erweiterte Einstellungen........................................................ 16

Andere

Fehlerbehebung ................................................................... 17

Weitere Hinweise................................................................... 18

Allgemeine technische Daten................................................ 19

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Sicherheitshinweise

Vor d em Start

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

'DV%OLW]V\PEROPLW3IHLOLQQHUKDOEHLQHVJOHLFKVHLWLJHQ'UHLHFNV

VROOGHQ$QZHQGHUDXIGDV9RUKDQGHQVHLQYRQ³JHIlKUOLFKHQ

6SDQQXQJHQ´LP,QQHUHQGHV*HKlXVHVGLHVHV3URGXNWHV

DXIPHUNVDPPDFKHQ'HUDUWLJH6SDQQXQJHQVLQGKRFKJHQXJ

XPIU0HQVFKHQJHIlKUOLFKH6FKOlJH]XEHZLUNHQ

'DV$XVUXIXQJV]HLFKHQLQQHUKDOEHLQHVJOHLFKVHLWLJHQ

'UHLHFNVVROOGHQ$QZHQGHUDXIGDV9RUKDQGHQVHLQYRQ

ZLFKWLJHQ%HWULHEVRGHU:DUWXQJVKLQZHLVHQ6HUYLFHLQ

GHUGHP3URGXNWEHLOLHJHQGHQ'RNXPHQWDWLRQKLQZHLVHQ

9256,&+7

806,&+1,&+7'(5*()$+5(,1(6(/(.75,6&+(16&+/$*(6

$86=86(7=(1'h5)(16,(1,&+7'(1'(&.(/2'(5',(

5h&.6(,7((17)(51(1,0*(5b7(,11(5(1%(),1'(16,&+

.(,1(920%(187=(55(3$5,(5%$5(17(,/(h%(5/$66(1

6,(5(3$5$785(1'(048$/,),=,(57(1.81'(1',(167

:$5181*

806,&+1,&+7'(5*()$+5(,1(6(/(.75,6&+(16&+/$*(6

$86=86(7=(1'h5)(16,(1,&+7'(1'(&.(/2'(5',(

5h&.6(,7((17)(51(1,0*(5b7(,11(5(1%(),1'(16,&+

.(,1(920%(187=(55(3$5,(5%$5(17(,/(h%(5/$66(1

6,(5(3$5$785(1'(048$/,),=,(57(1.81'(1',(167

'LHVHV*HUlWLVWQLFKWZDVVHUGLFKW=XU9HUPHLGXQJGHU*HIDKU

YRQ%UDQGXQG6WURPVFKODJNHLQH%HKlOWHUPLW)OVVLJNHLWHQ]%

%OXPHQYDVHQXQGW|SIHLQGLH1lKHGHV*HUlWHVEULQJHQXQGGLHVHV

YRU7URSIZDVVHU6SULW]ZDVVHU5HJHQXQG1lVVHVFKW]HQ

.HLQH4XHOOHQRႇHQHU)ODPPHQ]%HLQHEUHQQHQGH.HU]HDXIGLHVHV

*HUlWVWHOOHQ

%HZDKUHQ6LH%DWWHULHQQLFKWLQGLUHNWHP6RQQHQOLFKWRGHUDQDQGHUHQ

H[WUHPKHLHQ2UWHQDXIZLH]%LP,QQHQUDXPHLQHV)DKU]HXJVRGHU

LQGHU1lKHHLQHU+HL]XQJ'DGXUFKN|QQHQGLH%DWWHULHQDXVODXIHQ

VLFKEHUKLW]HQH[SORGLHUHQRGHULQ%UDQGJHUDWHQ$XFKNDQQGLHVGLH

/HEHQVGDXHUGHU%DWWHULHQYHUULQJHUQ

.OHLQH7HLOHDXHUKDOEGHU5HLFKZHLWHYRQ.OHLQNLQGHUQXQG.LQGHUQ

DXIEHZDKUHQ%HLXQEHDEVLFKWLJWHP9HUVFKOXFNHQLVWXQYHU]JOLFKHLQ

$U]WDXI]XVXFKHQ

,P*HUlWHJHKlXVHVLQG9HQWLODWLRQVVFKOLW]HXQGDQGHUHgႇQXQJHQYRUJHVHKHQ

GLHGD]XGLHQHQHLQHhEHUKLW]XQJGHV*HUlWHV]XYHUKLQGHUQXQGHLQHQ

]XYHUOlVVLJHQ%HWULHE]XJHZlKUOHLVWHQ8P%UDQGJHIDKUDXV]XVFKOLHHQ

GUIHQGLHVHgႇQXQJHQDXINHLQHQ)DOOEORFNLHUWRGHUPLW*HJHQVWlQGHQ]%

=HLWXQJHQ7LVFKGHFNHQXQG*DUGLQHQDEJHGHFNWZHUGHQXQGGDV*HUlWGDUI

EHLP%HWULHEQLFKWDXIHLQHPGLFNHQ7HSSLFKRGHU%HWWDXIJHVWHOOWVHLQ

%HL(LQVHW]HQHLQHV$NNXVGHVIDOVFKHQ7\SVEHVWHKW([SORVLRQVJHIDKU

(VEHVWHKW([SORVLRQVJHIDKUZHQQ%DWWHULHQLQRႇHQHV)HXHURGHUKHLH

gIHQJHODQJHQRGHUPHFKDQLVFK]HUVW|UWRGHU]HUVFKQLWWHQZHUGHQ

9RUVLFKWVPDQDKPHQ

$FKWHQ6LHEHL$XIVWHOOXQJGHV*HUlWHVLQHLQHP6FKUDQNRGHU

%FKHUERUGDXIHLQHHLQZDQGIUHLH/IWXQJ

$QGHU2EHUVHLWHXQGGHQ6HLWHQPXVVHLQ)UHLUDXPYRQFPJHODVVHQ

ZHUGHQ$QGHU5FNVHLWHPVVHQPLQGHVWHQVFPIUHLVHLQ=ZLVFKHQGHU

5FNVHLWHGHV6FKUDQNVRGHU%FKHUERUGVPXVVHLQ)UHLUDXPYRQPLQGHVWHQV

FPJHODVVHQZHUGHQXPGLH$EIXKUGHU:DUPOXIW]XJHZlKUOHLVWHQ

%HWULHEVXPJHEXQJ

%HWULHEVWHPSHUDWXUXQG%HWULHEVOXIWIHXFKWLJNHLW&ELV&)

ELV)UHO)HXFKWHPD[9HQWLODWLRQVVFKOLW]HQLFKWEORFNLHUW

(LQH$XIVWHOOXQJGLHVHV*HUlWDQHLQHPXQ]XUHLFKHQGEHOIWHWHQVHKU

IHXFKWHQRGHUKHLHQ2UWLVW]XYHUPHLGHQXQGGDV*HUlWGDUIZHGHUGLUHNWHU

6RQQHQHLQVWUDKOXQJQRFKVWDUNHQ.XQVWOLFKWTXHOOHQDXVJHVHW]WZHUGHQ

:LFKWLJHUKLQZHLV

'LHPRGHOOQXPPHUXQGGLHVHULHQQXPPHUGLHVHVJHUlWVEH¿QGHQVLFKDXIGHU

JHUlWHUFNRGHUXQWHUVHLWH1RWLHUHQVLHGLHVHQXPPHUQDXIGHUEHLJHIJWHQ

JDUDQWLHNDUWHXQGEHZDKUHQVLHGLHVH]XUNQIWLJHQUHIHUHQ]DQHLQHPVLFKHUHQRUWDXI

$&+781*

0LWGHU1HW]WDVWHDQGLHVHP*HUlWZLUGQLFKWGLHJHVDPWH6WURP]XIXKU

YRQGHU1HW]VWHFNGRVHXQWHUEURFKHQ8PGDV*HUlWYROOVWlQGLJYRP

1HW]]XWUHQQHQPXVVGHU1HW]VWHFNHUDXVGHU1HW]VWHFNGRVHJH]RJHQ

ZHUGHQ'DKHUVROOWHGDV*HUlWVRDXIJHVWHOOWZHUGHQGDVVVWHWVHLQ

XQEHKLQGHUWHU=XJDQJ]XU1HW]VWHFNGRVHJHZlKUOHLVWHWLVWGDPLWGHU

1HW]VWHFNHULQHLQHU1RWVLWXDWLRQVRIRUWDEJH]RJHQZHUGHQNDQQ8P

%UDQGJHIDKUDXV]XVFKOLHHQVROOWHGHU1HW]VWHFNHUYRUHLQHPOlQJHUHQ

1LFKWJHEUDXFKGHV*HUlWHVEHLVSLHOVZHLVHZlKUHQGGHV8UODXEV

JUXQGVlW]OLFKYRQGHU1HW]VWHFNGRVHJHWUHQQWZHUGHQ

'LHVHV*HUlWLVWIUGHQ+HLPJHEUDXFKYRUJHVHKHQ)DOOVEHL(LQVDW]

]XHLQHPDQGHUHP=ZHFN]%/DQJ]HLWJHEUDXFK]XJHZHUEOLFKHQ

=ZHFNHQLQHLQHP5HVWDXUDQWRGHU%HWULHELQHLQHP)DKU]HXJE]Z

6FKLႇHLQH)XQNWLRQVVW|UXQJDXIWULWWGLHHLQH5HSDUDWXUGHV*HUlWHV

HUIRUGHUOLFKPDFKWZHUGHQGLH5HSDUDWXUNRVWHQGHP.XQGHQVHOEVWGDQQ

LQ5HFKQXQJJHVWHOOWZHQQGLH*DUDQWLHIULVWQRFKQLFKWDEJHODXIHQLVW

6LFKHUKHLWVKLQZHLVH]XPQHW]NDEHO

)DVVHQ6LHGDV1HW]NDEHOVWHWVQXUDP6WHFNHUDQ=LHKHQ6LHGHQ1HW]VWHFNHU

QLFKWDXVGHU1HW]VWHFNGRVHLQGHP6LHDP.DEHO]LHKHQXQGEHUKUHQ6LH

GDV1HW]NDEHOQLFKWPLWIHXFKWHQRGHUQDVVHQ+lQGHQ$QGHUHQIDOOVNDQQHV]X

.XU]VFKOVVHQXQG6WURPVFKOlJHQNRPPHQ3ODW]LHUHQ6LHZHGHUGLHVHV*HUlW

QRFKDQGHUH*HJHQVWlQGHZLH0|EHODXIGHP1HW]NDEHOXQGNQLFNHQ6LHGDV

.DEHOQLFKW9HUNQRWHQ6LHGDV.DEHOQLFKWXQGYHUNQSIHQVLHHVQLFKWPLWDQGHUHQ

.DEHOQ)KUHQ6LHGDV1HW]NDEHOVRGDVVHVNHLQH6WROSHUJHIDKUGDUVWHOOW

%HVFKlGLJWH1HW]NDEHOVWHOOHQHLQ%UDQGXQG6WURPVFKODJULVLNRGDUhEHUSUIHQ6LH

UHJHOPlLJGHQ=XVWDQGGHV1HW]NDEHOV:HQQ6LH6FKlGHQIHVWVWHOOHQODVVHQ6LH

GDV1HW]NDEHOEHLP+lQGOHURGHUHLQHPDXWRULVLHUWHQ6HUYLFH]HQWUXPHUVHW]HQ

$&+781*

%HLGLHVHP*HUlWKDQGHOWHVVLFK]ZDUXPHLQ/DVHUSURGXNWGHU.ODVVH

GDVHQWVSUHFKHQGGHP6WDQGDUG6LFKHUKHLWIU/DVHUSURGXNWH,(&

NODVVL¿]LHUWLVW

LASER KLASSE 1

,QIRUPDWLRQHQIU$QZHQGHU]XU6DPPOXQJXQG(QW

VRUJXQJYRQ$OWJHUlWHQXQGJHEUDXFKWHQ%DWWHULHQ

Symbolbeispiele

für Batterien

Symbol für

Geräte

'LHVH6\PEROHDXIGHQ3URGXNWHQGHU9HUSDFNXQJXQGRGHU

%HJOHLWGRNXPHQWHQEHGHXWHQGDVVJHEUDXFKWHHOHNWULVFKHXQG

HOHNWURQLVFKH3URGXNWHXQG%DWWHULHQQLFKWEHUGHQ+DXVKDOWVPOO

HQWVRUJWZHUGHQGUIHQ

=XUULFKWLJHQ+DQGKDEXQJ5FNJHZLQQXQJXQG:LHGHUYHUZHUWXQJ

YRQ$OWSURGXNWHQXQGJHEUDXFKWHQ%DWWHULHQEULQJHQ6LHGLHVHELWWH

]XGHQJHPlGHUQDWLRQDOHQ*HVHW]JHEXQJGDIU]XVWlQGLJHQ

6DPPHOVWHOOHQ

0LWGHUNRUUHNWHQ(QWVRUJXQJGLHVHU3URGXNWHXQG%DWWHULHQKHOIHQ

6LHGDEHLZHUWYROOH5HVVRXUFHQ]XVFKRQHQXQGYHUPHLGHQ

P|JOLFKHQHJDWLYH$XVZLUNXQJHQDXIGLH*HVXQGKHLWXQGGLH

8PZHOWGLHGXUFKHLQHXQVDFKJHPlH%HKDQGOXQJGHV$EIDOOV

HQWVWHKHQN|QQWHQ

:HLWHUH,QIRUPDWLRQHQ]XU6DPPOXQJXQG:LHGHUYHUZHUWXQJ

YRQ$OWSURGXNWHQXQG%DWWHULHQHUKDOWHQ6LHYRQ,KUHU|UWOLFKHQ

*HPHLQGHYHUZDOWXQJ,KUHP0OOHQWVRUJHURGHUGHP9HUNDXIVRUW

DQGHP6LHGLH:DUHQHUZRUEHQKDEHQ

'LHVH6\PEROHJHOWHQDXVVFKOLHOLFKLQGHU(XURSlLVFKHQ8QLRQ

)U/lQGHUDXHUKDOEGHU(XURSlLVFKHQ8QLRQ

:HQQ6LHGLHVH*HJHQVWlQGHHQWVRUJHQZROOHQZHQGHQ6LHVLFK

ELWWHDQ,KUHORNDOHQ%HK|UGHQRGHU+lQGOHUXQGIUDJHQ6LHGRUW

QDFKGHUNRUUHNWHQ(QWVRUXQJVZHLVH

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Lieferumfang

1. Hauptgerät (1)

2. Fernbedienung (RC-980C) (1), Batterien (AAA/R03) (2)

3. Analoges Audiokabel (für den Testbetrieb) (1)

4. Netzkabel (1)

• Bedienungsanleitung (das vorliegende Dokument) (1)

• Das Netzkabel darf erst angeschlossen werden, wenn alle anderen Kabelverbindungen

hergestellt wurden.

• Wir übernehmen keine Haftung für Schäden, die beim Anschließen von

Drittanbietergeräten entstehen.

• Änderungen der technischen Daten und des Erscheinungsbildes ohne vorherige

Ankündigung vorbehalten.

Das Gerät kann nicht mit der Fernbedienung ein-/ausgeschaltet werden. Verwenden Sie

dazu die 8 STANDBY/ON-Taste am Hauptgerät.

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Bedienfeld

Teilenamen

1. 8 STANDBY/ON-Taste/-Anzeige: Hier wird das Gerät ein-/ausgeschaltet. Beim

Gerätestart leuchtet die Anzeige in der Mitte der Taste blau auf.

2. STANDBY Anzeige: Leuchtet rot, wenn sich das Gerät im Standby-Modus befindet.

3. Disc-Fach: Geben Sie Discs hier ein. Es können auch 8-cm-Discs verwendet werden.

4. ; Taste: Öffnen/Schließen Sie das Disc-Fach.

5. Wiedergabetasten:

u t : Zurück zum Anfang des Tracks, der gerade wiedergegeben wird. Noch einmal

drücken, um zum vorigen Track zu springen. Gedrückt halten, um einen schnellen

Rücklauf des Tracks auszuführen.

/h : Wiedergabe starten/pausieren.

y i : Hiermit können Sie während der Wiedergabe zum nächsten Track springen.

Gedrückt halten, um einen schnellen Vorlauf des Tracks auszuführen.

: Mit dieser Taste wird die Wiedergabe gestoppt.

6. Fernbedienungssensor

• Der Empfangsbereich der Fernbedienung liegt in einem Abstand von ca. 16´/5 m und

einem Winkel von 20° in vertikaler Richtung und 30° nach rechts und links.

7. CD/SACD-Taste/-Anzeige: Schaltet zwischen CD/SACD als Quelle um. Wird dieser

Schalter während der Wiedergabe einer Hybrid-SACD gedrückt, wird die

wiedergegebene Schicht gewechselt. (P18)

Die Anzeige leuchtet blau, wenn SACD ausgewählt ist.

8. DIRECT-Taste/-Anzeige: Schalten Sie den DIRECT-Modus ein/aus. (P15)

Die Anzeige leuchtet blau, wenn der DIRECT-Modus eingeschaltet ist.

9. Display (P7)

10.

SOURCE Taste: Wechselt die Wiedergabequelle.

11.

SETUP Taste: Zeigt das SETUP-Menü an. (P16)

6bkbl87 9

14352

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Rückseite

1. ANALOG OUT-Buchse: Verwenden Sie ein analoges Audiokabel, um beispielsweise

einen integrierten Verstärker anzuschließen.

2. AC IN: Schließen Sie das mitgelieferte Netzkabel an.

3. USB DAC-Anschluss: Verwenden Sie ein USB-Kabel (A-B-Typ), um einen Computer

anzuschließen.

4. DIGITAL OUT OPTICAL/COAXIAL-Buchse: Verwenden Sie ein digitales optisches Kabel

oder ein digitales Koaxialkabel, um beispielsweise einen integrierten Verstärker

anzuschließen.

5. CONTROL IN/OUT-Buchse: Werden Verstärker oder Audiogeräte von Pioneer

angeschlossen, ist eine zentrale Bedienung dieser Geräte möglich.

345

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Fernbedienung

1. ^ STANDBY/ON-Taste: Wenn das Gerät eingeschaltet

ist, wird es hiermit ausgeschaltet bzw. in den Standby-

Modus geschaltet. Das Gerät kann nicht mit der

Fernbedienung ein-/ausgeschaltet werden.

2. SHUFFLE Taste: Stellen Sie die zufällige Wiedergabe

ein. (P13)

3. REPEAT Taste: Stellen Sie die wiederholte Wiedergabe

ein. (P13)

4. Zifferntasten: Hiermit können Sie bei der Suche nach

Tracks direkt die Track-Nummer einer Musik-CD

eingeben. Auch verwendet, um Track-Nummern für die

Programmwiedergabe einzugeben.

5. CLEAR Taste: Löscht die für die Programmwiedergabe

festgelegten Inhalte. (P13)

6. DIGITAL FILTER Taste: Wählt zwischen drei Arten von

DIGITAL FILTER. (P15)

7. Cursortasten, ENTER-Taste: Wählen Sie das Element

mit den Cursortasten aus und drücken Sie zum

Bestätigen ENTER.

8. SETUP Taste: Zeigt das SETUP-Menü an. (P16)

9. Wiedergabetasten:

u : Zurück zum Anfang des Tracks, der gerade

wiedergegeben wird. Noch einmal drücken, um zum

vorigen Track zu springen.

/h : Wiedergabe starten/pausieren.

i : Weiter zum nächsten Track.

t : Gedrückt halten, um im aktuellen Track schnell

zurückzuspulen.

g : Wiedergabe stoppen.

y : Gedrückt halten, um im aktuellen Track schnell

vorzuspulen.

10.

SOURCE Taste: Wechselt die Wiedergabequelle.

11.

DIRECT Taste: Schalten Sie den DIRECT-Modus ein/

aus. (P15)

12.

DISPLAY Taste: Schaltet die Informationen auf der

Anzeige um.

• Je nach Quelle wird der Vorgang möglicherweise nicht

gestartet.

13.

; OPEN/CLOSE Taste: Öffnen/Schließen Sie das Disc-

Fach.

14.

PROGRAM Taste: Wird für die Programmwiedergabe

verwendet. (P13)

15.

LOCK RANGE Taste: Der LOCK RANGE ADJUST-

Einstellungsbildschirm wird angezeigt. (P15)

16.

RETURN Taste: Stellt die vorige Anzeige wieder her.

17.

UP SAMPLING-Taste: Schalten Sie die Funktion UP

SAMPLING auf ON und OFF. (P15)

18.

CD/SACD-Taste: Schaltet zwischen CD/SACD als Quelle

um. Wird dieser Schalter während der Wiedergabe einer

Hybrid-SACD gedrückt, wird die wiedergegebene Schicht

gewechselt. (P18)

19.

DIGITAL OUT Taste: Schaltet den Digitalausgang ein

und aus. (P16)

20.

DISPLAY OFF Taste: Schalten Sie das Display dieses

Geräts aus. Noch einmal drücken, um das Display

einzuschalten.

21.

DIMMER Taste: Sie können die Helligkeit des Displays in

drei Schritten anpassen. (Standardwert: Stufe 3)

bl bt

bm ck

Beachten Sie die

Polarität beim Einsetzen

der Batterien.

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Display

1. Leuchtet während der SACD- und DSD-Wiedergabe.

2. Anzeige von Meldungen: Hier werden Informationen zu Tracks und Menüs angezeigt.

3. Leuchtet, wenn Bedienvorgänge mit den Cursortasten der Fernbedienung möglich sind.

4. Der Wiedergabestatus wird angezeigt.

5. Leuchtet, wenn die Einstellung der digitalen Audioausgabe aktiviert ist. (P16)

6. Leuchtet, wenn Informationen wie die verbleibende Zeit des Tracks oder der Disc oder die

Gesamtspielzeit der Disc angezeigt werden.

7. Anzeige, wenn eine MQA-Datei oder ein Stream abgespielt wird. Einzelheiten siehe

"Wiedergabe von MQA". (P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Vor dem Start > Teilenamen >Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Verbindungen mit einem Verstärker

Installation

Sie können den Ton einer auf diesem Gerät abgespielten

Disc sowie von anderen Geräten, die mit diesem Gerät

verbunden sind, über Lautsprechersysteme wiedergeben,

welche an integrierte Verstärker oder AV-Receiver

angeschlossen sind. Nehmen Sie den Anschluss je nach

Eingangsbuchsen an Ihrem Verstärker vor.

Anschließen über ein analoges Audiokabel

Das Signal wird vom D/A-Wandler dieses Geräts in ein

analoges Signal umgewandelt und dann beispielsweise an

einen integrierten Verstärker ausgegeben. Verbinden Sie

die LINE-IN-Buchsen eines integrierten Verstärkers mit der

ANALOG OUT-Buchse (RCA-Buchse) an diesem Gerät.

Dieses Gerät

Integrierter Verstärker, AV-Receiver usw.

a Analoges Audiokabel

> Vor dem Start > Teilenamen >Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Anschluss über ein digitales optisches

Kabel

Das Signal wird z. B. vom D/A-Wandler des integrierten

Verstärkers in ein analoges Signal umgewandelt. Verbinden

Sie die OPTICAL IN-Buchse eines integrierten Verstärkers

mit der DIGITAL OUT OPTICAL-Buchse an diesem Gerät.

• Das Audio von SACD und DSD oder Eingabe von USB

DAC wird nicht von der DIGITAL OUT OPTICAL-Buchse

dieses Geräts ausgegeben.

• Bei den digitalen Signalen, die von diesem Gerät

ausgegeben werden können, handelt es sich um lineare

PCM-Signale mit einer Abtastfrequenz und

Quantisierungs-Bitrate von 192 kHz/24 Bit (der Betrieb

kann nicht mit allen Geräten und in allen Umgebungen

gewährleistet werden).

Anschluss über ein digitales Koaxialkabel

Das Signal wird z. B. vom D/A-Wandler des integrierten

Verstärkers in ein analoges Signal umgewandelt. Verbinden

Sie die COAXIAL IN-Buchse eines integrierten Verstärkers

mit der DIGITAL OUT COAXIAL-Buchse an diesem Gerät.

• Das Audio von SACD und DSD oder Eingabe von USB

DAC wird nicht von der DIGITAL OUT COAXIAL-Buchse

dieses Geräts ausgegeben.

• Bei den digitalen Signalen, die von diesem Gerät

ausgegeben werden können, handelt es sich um lineare

PCM-Signale mit einer Abtastfrequenz und

Quantisierungs-Bitrate von 192 kHz/24 Bit (der Betrieb

kann nicht mit allen Geräten und in allen Umgebungen

gewährleistet werden).

> Vor dem Start > Teilenamen >Installation > Wiedergabe

Erweiterte Einrichtung | Andere

CONTROL-Buchse

Wenn Sie über mehrere Pioneer-Markengeräte verfügen,

die CONTROL IN/OUT-Buchsen aufweisen, können Sie sie

z. B. zentral über den Fernbedienungssensor des

Verstärkers bedienen. Bei Verbinden mit Mono-

Ministeckerkabeln (ohne Widerstände) wie in der Abbildung

gezeigt können Sie auch dann die Fernbedienung

verwenden, um dieses Gerät und andere Geräte zu

bedienen, wenn sich die Geräte an Standorten befinden, an

denen sie vom Fernbedienungssignal nicht erreicht werden

können. Richten Sie dazu den Fernbedienungssensor z. B.

auf den Verstärker.

• Achten Sie darauf, zum Anschließen das analoge

Audiokabel zu verwenden. Über die Control-Buchse

alleine ist keine zentrale Bedienung möglich.

• Wenn Sie ein Mono-Ministeckerkabel (ohne Widerstand)

an die CONTROL IN-Buchse dieses Geräts anschließen,

funktioniert der Fernbedienungssensor an diesem Gerät

nicht mehr.

• Wenn Sie ein Mono-Ministeckerkabel (ohne Widerstand)

an die CONTROL OUT-Buchse dieses Geräts

anschließen, funktionieren die Fernbedienungssensoren

an den anderen Geräten nicht mehr.

• Wenn ein Netzwerk-Player der Marke Pioneer mit

Verstärker an die CONTROL IN/OUT-Buchse

angeschlossen wird, können Sie mithilfe einer

Smartphone-App grundlegende Bedienvorgänge an

diesem Gerät, dem Netzwerk-Player und dem Verstärker

über das Netzwerk vornehmen.

(Anschlussbeispiel)

CONTROL

OUT

CONTROL

OUT

Dieses Gerät

Verstärker

Audiogerät

a Mono-Ministeckerkabel (ohne Widerstand)

> Vor dem Start > Teilenamen >Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Anschließen des Netzkabels usw.

1 2

Anschließen des Netzkabels

Diesem Modell liegt ein abtrennbares Netzkabel bei.

Das Netzkabel darf erst angeschlossen werden, wenn alle

anderen Anschlüsse vorgenommen wurden. Achten Sie

darauf, das Netzkabel zunächst mit dem AC IN-Anschluss

am Gerät und anschließend mit der Steckdose zu

verbinden. Trennen Sie immer zuerst die Verbindung zur

Steckdose, wenn Sie das Netzkabel abziehen.

Gerätestart

Drücken Sie 8 STANDBY/ON am Hauptgerät.

• Drücken Sie beim Gerätestart die Taste in das Gehäuse

hinein. Beim Gerätestart leuchtet die Anzeige

8 STANDBY/ON in der Mitte der Taste blau auf.

a Netzkabel

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Wiedergabe von Discs

Wiedergabe

Informationen zu den Discs, die auf diesem Gerät

wiedergegeben werden können, finden Sie unter (P18).

Wiedergabe von Musik-CDs

Führen Sie den folgenden Schritten aus, wenn das Gerät

eingeschaltet ist.

1. Drücken Sie CD/SACD auf der Fernbedienung, um CD/

SACD als Quelle einzustellen.

2. Drücken Sie ; am Hauptgerät, um das Disc-Fach zu

öffnen. Drücken Sie nach Einlegen einer Disc erneut ;,

um das Fach zu schließen.

3. Drücken Sie /h (g) auf der Fernbedienung, um die

Wiedergabe zu starten.

4. Verwenden Sie die Wiedergabetasten (h), um die Wiedergabe

zu stoppen oder Tracks zur Wiedergabe auszuwählen. Sie

können die Auswahl auch vornehmen, indem Sie die Track-

Nummer mit den Zifferntasten (b) eingeben. Zur Eingabe einer

zweistelligen Track-Nummer drücken Sie die +10-Taste so oft,

wie der Wert der Zehnerstelle ist, und drücken Sie dann die

Zifferntaste für die Einerstelle. Durch Drücken von DISPLAY (d)

können Sie auswählen, ob die abgelaufene oder verbleibende

Wiedergabezeit der Disc usw. angezeigt werden soll.

• Die angezeigten Informationen sind von der Disc abhängig.

Wiedergabe von Discs mit Musikdateien

Führen Sie den folgenden Schritten aus, wenn das Gerät

eingeschaltet ist.

1. Drücken Sie CD/SACD auf der Fernbedienung, um CD/

SACD als Quelle einzustellen.

2. Drücken Sie ; am Hauptgerät, um das Disc-Fach zu

öffnen. Drücken Sie nach Einlegen einer Disc erneut ;,

um das Fach zu schließen.

3. Drücken Sie /h (g) auf der Fernbedienung, um die

Wiedergabe zu starten.

4. Verwenden Sie die Wiedergabetasten (h), um die Wiedergabe zu

stoppen oder Tracks zur Wiedergabe auszuwählen. Durch Drücken

von DISPLAY (d) können Sie auswählen, ob die abgelaufene oder

verbleibende Wiedergabezeit der Disc, der Dateiname des Tracks,

der Track-Name usw. angezeigt werden soll.

• Die angezeigten Inhalte sind von der Disc und der

Datei abhängig.

• Die Anzeige des Track-Namens wird nur bei

Musikdateien in den Formaten MP3/WMA/FLAC/AAC

(nur M4A)/DSD (nur DSF) unterstützt.

• Zeichen, die auf diesem Gerät nicht dargestellt werden

können, werden als "" angezeigt.

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Wiederholte Wiedergabe

1. Drücken Sie bei der Wiedergabe mehrfach REPEAT (a),

bis oder auf dem Display angezeigt wird.

: Wiederholung aller Tracks.

: Wiederholung des gerade wiedergegebenen Tracks.

Zum Abbrechen der wiederholten Wiedergabe drücken Sie

REPEAT (a) mehrmals, um auf dem Display anzuzeigen.

Zufällige Wiedergabe

1. Drücken Sie SHUFFLE (f) während der Wiedergabe oder

im Stoppbetrieb, um auf dem Display anzuzeigen.

: Zufallswiedergabe aller Tracks.

Zum Abbrechen der zufälligen Wiedergabe drücken Sie

SHUFFLE (f), um auf dem Display anzuzeigen.

Programmwiedergabe

Sie können die Wiedergabereihenfolge der Tracks auf einer

Musik-CD einstellen.

1. Drücken Sie PROGRAM (e), während die Wiedergabe

angehalten ist.

"P00" wird angezeigt, wenn noch keine Registrierung erfolgt

ist. Geben Sie mit den Zifferntasten (b) die Track-Nummer

ein, die Sie registrieren möchten. Zur Eingabe einer

zweistelligen Track-Nummer drücken Sie die +10-Taste so

oft, wie der Wert der Zehnerstelle ist, und drücken Sie dann

die Zifferntaste für die Einerstelle. Die Zahl in "P00" erhöht

sich jedes Mal, wenn ein Track registriert wurde. Es können

bis zu 24 Tracks registriert werden.

• Drücken Sie auf der Fernbedienung /h (g), um das

registrierte Programm wiederzugeben.

• Wenn Sie während der Registrierung von Tracks

CLEAR (c) drücken, werden die Tracks in der

umgekehrten Reihenfolge der Eingabe gelöscht,

beginnend mit dem zuletzt registrierten Track.

• Wenn Sie während der Registrierung von Tracks

PROGRAM (e) drücken, werden alle registrierten

Tracks gelöscht.

• Wenn die gesamte Spielzeit des registrierten

Programms 99 Minuten 59 Sekunden überschreitet,

wird " : " auf dem Display angezeigt.

ALL

OFF

Merkmale der Dateien, die wiedergegeben werden können

* Dateien mit mehr als 48 kHz müssen von einer DVD wiedergegeben werden.

Hinweise zu allen Dateitypen

• Verwenden Sie CD/CD-R/CD-RW-Discs, die dem CD-ROM-Dateisystemstandard ISO9660 Level 1/Level 2 entsprechen

und mit erweiterter Formatierung (Joliet und Romeo) geschrieben wurden. Bei DVD-Discs gilt zusätzlich, dass die Disc

mit dem UDF-Dateisystem geschrieben sein muss.

• Die Ordnerstruktur ist auf acht Ebenen begrenzt. Die maximale Anzahl der Tracks beträgt 3000. Je nach Ordnerstruktur

können jedoch möglicherweise nicht alle Ordner und Tracks erkannt und wiedergegeben werden.

Hinweise zu bestimmten Dateitypen

• Codieren Sie WMA-Dateien mit Anwendungen, die von Microsoft Corporation in den Vereinigten Staaten zertifiziert

wurden. Bei Verwendung nicht zertifizierter Anwendungen können Funktionsstörungen auftreten.

• Dieses Gerät unterstützt die Wiedergabe von AAC-Dateien mit der Erweiterung ".m4a", die mit iTunes codiert wurden.

Dateien, die mit DRM-Kopierschutz (Urheberrechtsschutz) geschützt sind oder mit bestimmten Versionen von iTunes

codiert wurden, können jedoch möglicherweise nicht wiedergegeben werden.

• WAV-Dateien enthalten unkomprimiertes digitales PCM-Audio.

• AIFF-Dateien enthalten unkomprimiertes digitales PCM-Audio.

Abtastraten Bitraten

Quantisierungsbit

Disc-Typen, die wiedergegeben

werden können

Erweiterung

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44,1/48 kHz

8 kbps bis 320 kbps

und VBR.

–.mp3

WMA 44,1/48 kHz

5 kbps bis 192 kbps

und VBR.

–.wma

AAC 44,1/48/88,2/96 kHz

8 kbps bis 320 kbps

und VBR.

–

.aac/

.m4a

WAV

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 Bit

.wav

AIFF

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 Bit

.aif/

.aiff

FLAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 Bit

.flac

ALAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 Bit

.m4a

DSD 2,8/5,6 MHz – 1 Bit –

.dsf/

.dff

MQA

44,1/48/88,2/96/176,4/

192/352,8/384 kHz

– 8/16/24 Bit

.flac/

.wav

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Verwenden dieses Geräts als D/A-Wandler

Sie können die digitalen Audiosignale vom PC auf diesem

Gerät in analoge Signale umwandeln und dann über die

ANALOG OUT-Buchsen ausgeben.

Quelle umschalten

1. Drücken Sie SOURCE an diesem Gerät oder an der

Fernbedienung, um die Quelle des Geräts auf

"USB DAC" umzuschalten.

Anschlüsse

2. Verwenden Sie ein USB-Kabel (A-B-Typ), um einen

Computer anzuschließen.

Wiedergabe

3. Starten Sie die Wiedergabe am Player.

• Bei den digitalen Signalen, die von diesem Gerät

ausgegeben werden können, handelt es sich um lineare

PCM-Signale mit einer Abtastfrequenz bzw.

Quantisierungs-Bitrate von 48 kHz/32 Bit (der Betrieb

kann nicht mit allen Geräten und in allen Umgebungen

gewährleistet werden).

• Die unterstützten Betriebssysteme des

anzuschließenden PCs sind Windows10

und

Mac OS X.

• Bei anderen als den unterstützten Betriebssystemen

wird der Ton möglicherweise unterbrochen oder nicht

ausgegeben.

• Abhängig von der Art der Verwendungsumgebung kann

die Wiedergabe u. U. nicht ordnungsgemäß ausgeführt

werden.

USB DAC

a USB-Kabel

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Anpassen der Klangqualität

Der Originalklang wird naturgetreu

reproduziert (DIRECT-Modus)

Verarbeitungen, welche die Klangqualität beeinträchtigen,

werden ausgeschaltet, damit ein naturgetreuerer Klang

ausgegeben werden kann.

(Standardwert): OFF

1. Drücken Sie DIRECT (d).

• Die DIRECT-Anzeige an der Vorderseite des

Hauptgeräts leuchtet, wenn der DIRECT-Modus auf ON

gestellt ist.

• Wenn der DIRECT-Modus auf ON gestellt ist, wird

DIGITAL OUT auf OFF geschaltet.

• Im DIRECT-Modus wird das Display bei der CD- und

SACD-Wiedergabe oder bei Anschließen von USB DAC

automatisch ausgeschaltet.

• Wenn Sie die Einstellung während der Wiedergabe

ändern, wird der Klang möglicherweise unterbrochen.

DIGITAL FILTER

Wählt zwischen drei Arten von DIGITAL FILTER.

1. Die Einstellung ändert sich bei jedem Drücken von

DIGITAL FILTER (a).

"SLOW": Weicher, flüssiger Klang

"SHARP" (Standardwert): Klang mit mehr Struktur und

Kontur

"SHORT": Zügiger, dynamischer Klang

• Sie können auch SETUP (c) drücken, um den DIGITAL

FILTER-Einstellungsbildschirm aus dem SETUP-Menü

zu öffnen. In diesem Fall wählen Sie den einzustellenden

Wert mit / (b) auf der Fernbedienung aus.

• Die Einstellung ist fest auf "SHORT" gesetzt, während

MQA-CD oder eine Disc mit Musikdateien abgespielt

wird, oder bei Verwendung von USB DAC.

• Wenn Sie die Einstellung während der Wiedergabe

ändern, wird der Klang möglicherweise unterbrochen.

UP SAMPLING

Durch ein Erhöhen der Abtastfrequenz kann eine

Klangreproduktion mit höherer Klarheit erzielt werden.

(Standardwert) : OFF

1. Sie können auch UP SAMPLING (g) drücken, um die

Funktion auf ON und OFF zu schalten.

• Diese Funktion kann nicht verwendet werden, wenn der

Modus DIRECT auf ON während der Wiedergabe von

SACD oder DSD gestellt ist.

• Die Einstellung ist fest auf "ON" gesetzt, während

MQA-CD oder eine Disc mit Musikdateien abgespielt

wird, oder bei Verwendung von USB DAC.

• Wenn Sie die Einstellung während der Wiedergabe

ändern, wird der Klang möglicherweise unterbrochen.

Sperrbereich anpassen

(LOCK RANGE ADJUST)

Die Klangqualität wird erhöht, indem der Sperrbereich für

Zufallsgeräusche verringert wird. Wird der Sperrbereich

jedoch zu stark verringert, kann es zu

Wiedergabeunterbrechungen und Störgeräuschen

kommen. Passen Sie den Sperrbereich während einer

Audiowiedergabe an.

(Standardwert): RANGE 6

1. Drücken Sie LOCK RANGE (e).

2. Wählen Sie den einzustellenden Wert mit / (f) auf der

Fernbedienung aus.

"RANGE 6" (breit) bis "RANGE 1" (schmal)

• Sie können auch SETUP (c) drücken, um den LOCK

RANGE ADJUST-Einstellungsbildschirm aus dem

SETUP-Menü zu öffnen.

• Die Einstellung ist fest auf "6" gesetzt, während MQA-CD

oder eine Disc mit Musikdateien abgespielt wird, oder bei

Verwendung von USB DAC.

• LOCK RANGE ADJUST hat keine Auswirkung auf die

SACD- und DSD-Wiedergabe.

• Wenn Sie die Einstellung während der Wiedergabe

ändern, wird der Klang möglicherweise unterbrochen.

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung |Andere

Erweiterte Einstellungen

Erweiterte Einrichtung

Mit den erweiterten Einstellungen dieses Geräts können Sie

Leistung und Bedienfreundlichkeit individuell anpassen.

1. Drücken Sie SETUP auf der Fernbedienung.

2. Wählen Sie den Inhalt oder die Einstellung mit den

Cursortasten der Fernbedienung aus und drücken Sie

ENTER, um die Auswahl zu bestätigen. Um zum vorigen

Bildschirm zurückzukehren, drücken Sie RETURN.

3. Drücken Sie SETUP, um die Einstellungen zu verlassen.

AUTO STANDBY

Diese Einstellung schaltet das Gerät nach 20 Minuten

Inaktivität ohne Audioeingang automatisch in den Standby-

Modus.

"ON" (Standardwert): Das Gerät schaltet automatisch in den

Standby-Modus.

"OFF": Das Gerät wird nicht automatisch in den Standby-

Modus geschaltet.

POWER ON PLAY

Sie können das Gerät so einstellen, dass es nach dem

Einschalten automatisch die eingelegte Disc abspielt.

• Durch automatisches Einschalten der Stromversorgung

mittels einer extern angeschlossenen Zeitschaltuhr

können Sie eine zeitgesteuerte Wiedergabe einstellen.

"ON": Discs werden automatisch wiedergegeben

"OFF" (Standardwert): Discs werden nicht automatisch

wiedergegeben

DIGITAL OUT

Nehmen Sie Einstellungen für die digitale Audioausgabe

vor. Wird die Verbindung nicht über die Buchse DIGITAL

OUT OPTICAL/COAXIAL hergestellt, wird der Ton noch

klarer wiedergegeben, wenn Sie diesen Wert auf OFF

stellen.

"ON" (Standardwert), "OFF"

DIGITAL FILTER

Sie konnen auswahlen, welche Art von DIGITAL FILTER

verwendet werden soll. (P15)

UP SAMPLING

Durch ein Erhöhen der Abtastfrequenz kann eine

Klangreproduktion mit höherer Klarheit erzielt werden.

(P15)

LOCK RANGE ADJUST

Sie können den Sperrbereich anpassen. (P15)

LOADING MODE

Die Ladezeit für CD kann verkürzt werden.

• Durch Aktivieren dieser Funktion kann die Ladezeit je

nach CD verkürzt werden, zu Beginn der Wiedergabe

kann es jedoch zu Klangaussetzern kommen.

"NORMAL" (Standardwert): Wenn die Ladezeit für CD nicht

verkürzt wird

"FAST": Wenn die Ladezeit für CD verkürzt wird

AUTO STANDBY

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Fehlerbehebung

Andere

Bevor Sie den Vorgang starten

Bei instabilem Betrieb können Probleme möglicherweise

durch einfaches Aus-/Einschalten, Schalten in den Standby-

Modus oder Abtrennen und erneutes Anschließen des

Netzkabels anstatt durch Überprüfen von Einstellungen und

Bedienvorgängen behoben werden. Versuchen Sie die

einfachen Maßnahmen jeweils am Gerät und der daran

angeschlossenen Komponente. Wenn das Problem nach

Ausführen der Maßnahmen unter "Fehlerbehebung" weiterhin

besteht, kann es möglicherweise behoben werden, indem

das Gerät in den Auslieferungszustand zurückgesetzt wird.

Zurücksetzen des Geräts (die werksseitigen

Standardeinstellungen werden wiederhergestellt)

1. Während das Gerät eingeschaltet und keine Disc

eingelegt ist, halten Sie g auf dem Hauptgerät gedrückt

und drücken Sie DIRECT.

2. Auf der Anzeige erscheint die Meldung "CLEAR", das

Gerät wird in den Standby-Modus geschaltet, und die

Einstellungen werden zurückgesetzt.

■ Stromversorgung

Das Gerätlässt sich nicht einschalten

• Ziehen Sie das Netzkabel aus der Steckdose, warten Sie

mindestens 2 Minuten und stecken Sie es dann wieder ein.

Das Gerät schaltet sich unerwartet ab

• Das Gerät wird automatisch in den Standby-Modus

geschaltet, wenn die Einstellung "AUTO STANDBY" im

SETUP-Menü aktiviert ist.

Die STANDBY-Anzeige am Hauptgerät blinkt weiterhin

rot, und es sind keine Bedienvorgänge möglich

• Ziehen Sie das Netzkabel aus der Steckdose, warten Sie

mindestens 2 Minuten und stecken Sie es dann wieder ein.

Drücken Sie trotz weiterhin blinkender Anzeige

STANDBY/

ON auf dem Hauptgerät, um die Netzstromversorgung

einzuschalten (ON). Wenn das Problem damit nicht behoben

ist, handelt es sich möglicherweise um einen Funktionsfehler.

Entfernen Sie das Netzkabel aus der Steckdose und wenden

sich an Ihren Händler oder unseren Kundendienst, um sich

unterstützen zu lassen.

■ Das Display leuchtet nicht

• Es ist möglich, dass das Display durch Drücken von

DISPLAY OFF ausgeschaltet wurde. Drücken Sie

DISPLAY OFF, um das Display einzuschalten.

■

Es können keine Discs wiedergegeben werden

• Legen Sie die Disc mit der beschrifteten Seite nach oben

in das Disc-Fach ein.

• Es ist eventuell keine Wiedergabe möglich, wenn die

Disc verkratzt oder verschmutzt ist.

• Tondateien, die urheberrechtlich geschützt sind, können

nicht abgespielt werden.

• Das Disc-Fach öffnet sich, wenn Sie eine Disc einlegen,

die dieses Gerät nicht unterstützt.

■ Audio

Ton ist unterbrochen

• Wird der Sperrbereich über die LOCK RANGE ADJUST-

Einstellung zu stark verringert, kann es zu

Wiedergabeunterbrechungen und Störgeräuschen kommen.

Wiedergabeunterbrechungen durch Anpassungen des

Sperrbereichs sind kein Garantiefall. Passen Sie den

Sperrbereich während einer Audiowiedergabe an.

Es erfolgt keine digitale Klangausgabe

• Stellen Sie "DIGITAL OUT" im SETUP-Menü auf "ON" ein.

• Das Audio von SACD und DSD oder Eingabe von USB

DAC ist keine digitale Ausgabe.

■ Fernbedienung

• Stellen Sie sicher, dass die Batterien mit der richtigen

Polarität eingelegt sind.

• Legen Sie neue Batterien ein. Keine Batterien unterschiedlicher

Sorten oder alte und neue Batterien mischen.

• Achten Sie darauf, dass das Gerät keinem direkten

Sonnenlicht oder Invertertyp-Leuchtstofflampenlicht

ausgesetzt wird. Ändern Sie den Standort, falls notwendig.

• Wenn dieses Gerät in einem Gestell oder einem

Gehäuse mit gefärbten Glastüren installiert ist und die

Türen geschlossen sind, funktioniert die Fernbedienung

möglicherweise nicht einwandfrei.

■ D/A-Wandlerfunktion

• Vergewissern Sie sich, dass jede Videokomponente

ordnungsgemäß angeschlossen ist.

• Geben Sie Audiodaten wieder, die mit den

Eingangsbuchsen dieses Geräts kompatibel sind. (



P14)

Es ist keine Audiowiedergabe vom Computer möglich

• Deaktivieren Sie die Stummschaltfunktion am Computer.

• Wählen Sie in den Audioausgabeeinstellungen des

Computers dieses Gerät aus. Wenn die Quelle dieses

Geräts eine andere Einstellung als “USB DAC” aufweist,

wird das Gerät vom PC nicht erkannt.

• Werden mehrere Anwendungen gleichzeitig auf dem

Computer ausgeführt, schließen Sie die Anwendungen,

die Sie nicht benötigen.

Die Abtastfrequenz über den USB DAC-Eingang bleibt

immer gleich

• Je nach Einstellungen des Computers werden

unterschiedliche Abtastfrequenzen verschiedener Dateien

für die Ausgabe zur gleichen Abtastfrequenz umgewandelt.

Andere Computersounds als Musik werden über den

USB DAC-Eingang empfangen

• Je nach Einstellungen des Computers werden

Computersounds wie der Ton beim Hochfahren oder

Fehlertöne möglicherweise über dieses Gerät ausgegeben.

■ SACD

• Aufgrund unterschiedlicher Aufzeichnungsmethoden

kann es zwischen der SACD- und der CD-Wiedergabe

einen Lautstärkenunterschied geben.

CLEAR

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Weitere Hinweise

■ Discs, die wiedergegeben werden können

Vorsichtsmaßnahmen bei der Wiedergabe

• Es können Compact-Discs (CDs) mit einem der folgenden

Logos auf der bedruckten Seite verwendet werden:

• Beachten Sie, dass einige CDs möglicherweise aufgrund

ihrer Eigenschaften, von Kratzern, Verschmutzungen oder

des Aufnahmestatus nicht wiedergegeben werden können.

Wiedergabe von MQA

Dieses Gerät enthält die MQA (Master Quality

Authenticated) Technology, die Wiedergabe von MQA-

Audiodateien und Streams erlaubt, wobei der Klang der

originalen Master-Aufnahme bewahrt wird.

Dieses Gerät ist ein CD-Player, der eine MQA-CD erkennen

kann. Der eingebaute MQA-Decoder stellt das hochaufgelöste

Signal, das im Studio gehört wird, wieder her und bestätigt es

mit der Authentifikations-Signatur.

Weitere Informationen finden Sie bei

www.mqa.co.uk/customer/mqacd.

‘MQA’ oder ‘MQA.’ zeigt an, dass das Produkt einen MQA-

Stream oder eine Datei decodiert und abspielt, und

bezeichnet die Herkunft, um sicherzustellen, dass der

Klang identisch mit dem des Quellmaterials ist. ‘MQA.’ zeigt

an, dass eine MQA Studio-Datei abgespielt wird, die

entweder im Studio vom Interpreten/Producer genehmigt

oder vom Urheberrechtsinhaber authentifiziert wurde.

Wiedergabe von Hybrid-SACDs

Hybrid-SACDs bestehen aus zwei Schichten: der SACD-

Schicht und der CD-Schicht. Drücken Sie CD/SACD, um

die Schicht auszuwählen, die Sie wiedergeben möchten.

Wiedergabe von DualDisks

Eine "DualDisk" enthält auf einer Seite Video- und

Audiodaten nach dem DVD-Standard und auf der anderen

Seite Audiodaten, die von einem CD-Player wiedergegeben

werden können.

Auf der Audioseite (d. h. nicht die DVD-Seite) ist eine

Wiedergabe nicht immer möglich, da die Disc nicht den

physikalischen Spezifikationen von Standard-CDs entspricht.

Bedienvorgänge während der Wiedergabe

Während der Wiedergabe von Discs mit Musikdaten kann

die Direktsuche nicht verwendet werden.

Disc-Typen, die von diesem Gerät nicht

wiedergegeben werden können

DVD-Video, DVD-Audio, CD-G, Video-CD, DTS-CD

Hinweise zu Discs

• Achten Sie darauf, beim Öffnen/Schließen des Disc-

Fachs Hand und Finger nicht einzuklemmen.

• Verwenden Sie keine CDs mit außergewöhnlicher Form

(z. B. Herzen oder Achtecke). Solche CDs können

verkanten und zu Geräteschäden führen.

• Einige Audio-CDs mit Kopierschutz genügen den offiziellen CD-

Standards nicht. Es handelt sich dabei um besondere CDs, die

von diesem Gerät nicht wiedergegeben werden können.

• Verwenden Sie keine CDs mit Klebebandrückständen,

Leih-CDs mit sich ablösenden Etiketten oder CDs mit

dekorativen Etiketten. Solche CDs können verkanten und

zu Geräteschäden führen.

• Belassen Sie Discs mit Etiketten, die mit

Tintenstrahldruckern bedruckt wurden, nicht über längere

Zeiträume im Gerät. Solche CDs können verkanten und

zu Geräteschäden führen.

■ Reinigen des Players

• In der Regel genügt es, den Player mit einem weichen Tuch

abzuwischen. Tragen Sie bei hartnäckigen Verschmutzungen ein

wenig in 5 bis 6 Teilen Wasser verdünnten Neutralreiniger auf ein

weiches Tuch auf. Wringen Sie das Tuch sorgfältig aus, wischen Sie

den Schmutz ab, und wischen Sie mit einem trockenen Tuch nach.

• Beachten Sie, dass das Auftragen von Alkohol, Verdünner,

Benzin oder Insektiziden auf den Player dazu führen kann,

dass sich Beschriftungen und Beschichtungen ablösen.

Vermeiden Sie außerdem, dass Gummi- oder Vinylprodukte

längere Zeit in Kontakt mit dem Player geraten, da dies das

Gehäuse beschädigen könnte.

•

Wenn Sie chemisch imprägnierte Wischtücher usw.

verwenden, lesen Sie sich die Vorsichtshinweise zu den

Produkten sorgfältig durch.

• Wenn sich auf dem CD-Fach anhaftender Staub nur

schwer entfernen lässt, bringen Sie ein Klebeband usw.

auf, um den Staub zu entfernen.

■

Vorsichtsmaßnahmen beim Bewegen des Geräts

Wenn das Gerät bewegt werden soll, entnehmen Sie die Disc

und schließen das Disc-Fach. Drücken Sie danach

STANDBY/ON am Hauptgerät, warten Sie noch

10 Sekunden, nachdem die Anzeige [OFF] erloschen ist, und

trennen Sie dann das Netzkabel ab. Wird das Gerät mit

eingelegter Disc bewegt, kann dies zu Beschädigungen führen.

■ Kondensation

Wenn dieses Gerät von einem kalten an einen warmen Ort gebracht

oder die Umgebung rasch erwärmt wird, beispielsweise durch eine

Heizung, so können sich im Gerät Wassertropfen bilden. Dies

bezeichnet man als Kondensation. Es kann dabei nicht nur zu

Fehlfunktionen, sondern auch zu Schäden am Gerät bzw. der

eingelegten CD kommen. Es wird empfohlen, CDs aus dem Gerät

zu entfernen, wenn das Gerät längere Zeit nicht verwendet wird.

Wenn das Risiko besteht, dass es zu Kondensation gekommen ist,

trennen Sie das Netzkabel ab und lassen das Gerät mindestens

3 Stunden lang bei Raumtemperatur stehen.

MQA-CD

SACD (Super-Audio-CD)

(Nur 2-Kanal-Bereich)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Vor dem Start > Teilenamen > Installation > Wiedergabe

Erweiterte Einrichtung | Andere

Allgemeine technische Daten

■ Analoger Audioausgang

Ausgangsnennleistungspegel und Impedanz

• RCA OUT: 2,3 Vrms (1 kHz, 0 dB) / 100 

Frequenzgang

• CD: 2 Hz - 20 kHz,

SACD: 2 Hz - 50 kHz (-3 dB)

Signal-/Rauschabstand

• CD: 116 dB oder mehr (A-Gewichtung),

SACD: 116 dB oder mehr (A-Gewichtung)

THD+N

• CD: 0,002 % oder weniger,

SACD: 0,002 % oder weniger

■ Digital-Audio-Eingang

USB DAC

• Typ B, USB Audio-Klasse 1.0

■ Digitaler Audioausgang

Digitaler koaxialer Ausgang

• RCA-Buchse, 0,5 Vp-p / 75 

Optischer koaxialer Ausgang

• Optische Buchse, -14 - -21 dBm / 660 nm

■ Sonstiges

Control-Eingang

• Ø3,5 Minibuchse (Mono)

Control-Ausgang

• Ø3,5 Minibuchse (Mono)

■ Allgemeine Daten

Stromversorgung

• AC 220 - 230 V, 50/60 Hz

Stromverbrauch

•43W

• 0,3 W (Im Standby-Modus)

AUTO STANDBY

• ON (20 min) / OFF

Abmessungen (B  H  T)

• 435 mm  138 mm  413 mm

Gewicht

• 13,1 kg

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

SUPER AUDIO CD PLAYER

PD-50AE

Gebruikers

handleiding

Vóór het Starten

Veiligheidsinformatie ............................................................... 2

Wat zit er in de doos ............................................................... 3

Namen van de onderdelen

Voorpaneel ............................................................................. 4

Achterpaneel .......................................................................... 5

Afstandsbediening .................................................................. 6

Display .................................................................................... 7

Installeren

Verbindingen met een versterker ............................................ 8

Het netsnoer verbinden, enz. ................................................11

Afspelen

Discs afspelen ...................................................................... 12

Dit toestel als D/A-converter gebruiken ................................ 14

Aanpassen van geluidskwaliteit ............................................ 15

Geavanceerde Setup

Geavanceerde instellingen .................................................... 16

Overige

Problemen oplossen ............................................................. 17

Overige opmerkingen ............................................................ 18

Algemene specificaties.......................................................... 19

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Veiligheidsinformatie

Vóór het Starten

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

'H]HOLFKWÀLWVPHWSLMOSXQWLQHHQJHOLMN]LMGLJHGULHKRHNGLHQWGH

JHEUXLNHUHURSDWWHQWWHPDNHQGDWHUQLHWJHwVROHHUGH³JHYDDUOLMNH

VSDQQLQJ´LQGHEHKXL]LQJYDQKHWWRHVWHOLVHQSHUVRQHQELMHHQ

YHUNHHUGHEHKDQGHOLQJHHQHOHNWULVFKHVFKRNRS]RXGHQNXQQHQORSHQ

+HWXLWURHSWHNHQLQHHQJHOLMN]LMGLJHGULHKRHNGLHQW

GHJHEUXLNHUHURSDWWHQWWHPDNHQGDWHUEHODQJULMNH

DDQZLM]LQJHQYRRUEHGLHQLQJHQRQGHUKRXGUHSDUDWLHLQGH

ELMKHWWRHVWHOJHOHYHUGHJHEUXLNVDDQZLM]LQJDDQZH]LJ]LMQ

23*(/(7

20+(7*(9$$59225((1(/(.75,6&+(6+2&.7(9225.20(1

'(.6(/2)58*1,(79(5:,-'(5(1$$1'(%,11(1=,-'(%(9,1'(1

=,&+*((1(/(0(17(1',('225'(*(%58,.(5.811(1%(',(1'

:25'(1(1.(/'225*(.:$/,),&((5'3(5621((/7(%(',(1(1

:$$56&+8:,1*

20+(7*(9$$59225((1(/(.75,6&+(6+2&.7(

9225.20(1'(.6(/2)58*1,(79(5:,-'(5(1$$1'(

%,11(1=,-'(%(9,1'(1=,&+*((1(/(0(17(1',('225

'(*(%58,.(5.811(1%(',(1':25'(1(1.(/'225

*(.:$/,),&((5'3(5621((/7(%(',(1(1

'LWDSSDUDDWLVQLHWZDWHUGLFKW2PEUDQGRIHHQHOHNWULVFKHVFKRNWH

YRRUNRPHQPDJXJHHQYRRUZHUSGDWYORHLVWRIEHYDWLQGHEXXUWYDQKHW

DSSDUDDW]HWWHQELMYRRUEHHOGHHQEORHPHQYDDVRIKHWDSSDUDDWRSDQGHUH

ZLM]HEORRWVWHOOHQDDQZDWHUGUXSSHOVRSVSDWWHQGZDWHUUHJHQRIYRFKW

2PEUDQGWHYRRUNRPHQPDJXJHHQRSHQYXXU]RDOVHHQEUDQGHQGH

NDDUVRSGHDSSDUDWXXU]HWWHQ

*HEUXLNRIEHZDDUEDWWHULMHQQLHWLQGLUHFW]RQOLFKWRIRSHHQKHWH

SODDWV]RDOVLQGHDXWRRIELMHHQNDFKHO%DWWHULMHQNXQQHQKLHUGRRU

JDDQOHNNHQRYHUYHUKLWWHQH[SORGHUHQRILQEUDQGYOLHJHQ%RYHQGLHQ

YHUPLQGHUWGLWGHOHYHQVGXXURISUHVWDWLHVYDQGHEDWWHULMHQ

%HUJNOHLQHRQGHUGHOHQRSEXLWHQKHWEHUHLNYDQNLQGHUHQHQSHXWHUV

5DDGSOHHJRQPLGGHOOLMNHHQDUWVLQGLHQNOHLQHRQGHUGHOHQSHURQJHOXN

ZRUGHQLQJHVOLNW

'HJOHXYHQHQRSHQLQJHQLQGHEHKXL]LQJYDQKHWDSSDUDDW]LMQ

DDQJHEUDFKWYRRUGHYHQWLODWLH]RGDWHHQEHWURXZEDUHZHUNLQJYDQKHW

DSSDUDDWZRUGWYHUNUHJHQHQRYHUYHUKLWWLQJZRUGWYRRUNRPHQ2PEUDQGWH

YRRUNRPHQPRHWXHUYRRU]RUJHQGDWGH]HRSHQLQJHQQRRLWJHEORNNHHUG

ZRUGHQRIGDW]HDIJHGHNWZRUGHQGRRUYRRUZHUSHQNUDQWHQWDIHONOHHG

JRUGLMQHGRIGRRUJHEUXLNYDQKHWDSSDUDDWRSHHQGLNWDSLMWRIHHQEHG

5LVLFRRSH[SORVLHDOVGHEDWWHULMGRRUHHQYHUNHHUGW\SHYHUYDQJHQZRUGW

([SORVLHULVLFR$OVHHQEDWWHULMZHJJHJRRLGZRUGWLQHHQYXXURIHHQKHWH

RYHQRIPHFKDQLVFKYHUEULM]HOGZRUGWRIDOVHULQJHVQHGHQZRUGW

9RRU]RUJVPDDWUHJHOHQ

$OVXKHWDSSDUDDWLQHHQRPVORWHQUXLPWHRSVWHOW]RDOVHHQDXGLRNDVWMH

RIERHNHQUHNPRHWXHURRNRSOHWWHQGDWHUYROGRHQGHYHQWLODWLHLV

=RUJHUYRRUGDWHUPLQVWHQVFPUXLPWHRSHQEOLMIWDDQGHERYHQNDQW

HQGH]LMNDQWHQHQFPDDQGHDFKWHUNDQW'HDFKWHUUDQGYDQHHQ

SODQNRISODDWGLHERYHQKHWDSSDUDDWLVPRHWFPYHUZLMGHUG]LMQ

YDQGHZDQGRIPXXU]RGDWHUHHQVRRUWVFKRRUVWHHQSLMSRSHQLQJLV

ZDDUGRRUGHZDUPHOXFKWNDQRQWVQDSSHQ

*HEUXLNVRPJHYLQJ

7HPSHUDWXXUHQYRFKWLJKHLGVJUDDGRSGHSODDWVYDQJHEUXLN&WRW

&)WRW)PLQGHUGDQ5+YHQWLODWLHRSHQLQJHQ

QLHWDIJHGHNW

=HWKHWDSSDUDDWQLHWRSHHQVOHFKWJHYHQWLOHHUGHSODDWVHQVWHOKHW

DSSDUDDWRRNQLHWEORRWDDQKRJHYRFKWLJKHLGRIGLUHFW]RQOLFKWRIVWHUNH

NXQVWPDWLJHYHUOLFKWLQJ

%HODQJULMNHPHGHGHOLQJ

+HWPRGHOQXPPHUHQKHWVHULHQXPPHUYDQGH]HXLWUXVWLQJVWDDQRSGH

DFKWHUNDQWRIGHRQGHUNDQW1RWHHUGH]HQXPPHUVRSXZELMJHVORWHQ

JDUDQWLHNDDUWHQEHZDDUGLHRSHHQYHLOLJHSODDWVYRRUWRHNRPVWLJH

UDDGSOHJLQJ

/(723

'HVWURRPVFKDNHODDURSGLWWRHVWHO]DOQLHWDOOHVWURRPYROOHGLJYDQKHW

VWRSFRQWDFWDIVOXLWHQ$DQJH]LHQHUQDKHWXLWVFKDNHOHQYDQKHWDSSDUDDW

QRJHHQNOHLQHKRHYHHOKHLGVWURRPEOLMIWORSHQPRHWXGHVWHNNHUXLW

KHWVWRSFRQWDFWKDOHQRPKHWDSSDUDDWYROOHGLJYDQKHWOLFKWQHWORVWH

NRSSHOHQ3ODDWVKHWDSSDUDDW]RGDQLJGDWGHVWHNNHULQHHQQRRGJHYDO

JHPDNNHOLMNXLWKHWVWRSFRQWDFWNDQZRUGHQJHKDDOG2PEUDQGWH

YRRUNRPHQPRHWXGHVWHNNHUXLWKHWVWRSFRQWDFWKDOHQZDQQHHUX

KHWDSSDUDDWODQJHUHWLMGQLHWGHQNWWHJHEUXLNHQELMYZDQQHHUXRS

YDNDQWLHJDDW

'LWDSSDUDDWLVEHVWHPGYRRUQRUPDDOKXLVKRXGHOLMNJHEUXLN,QGLHQ

KHWDSSDUDDWYRRUDQGHUHGRHOHLQGHQRIRSDQGHUHSODDWVHQZRUGW

JHEUXLNWELMYRRUEHHOGODQJGXULJJHEUXLNLQHHQUHVWDXUDQWYRRU]DNHOLMNH

GRHOHLQGHQRIJHEUXLNLQHHQDXWRRIERRWHQDOVJHYROJKLHUYDQGHIHFW

]RXUDNHQ]XOOHQGHUHSDUDWLHVLQUHNHQLQJJHEUDFKWZRUGHQRRNDOV

KHWDSSDUDDWQRJLQGHJDUDQWLHSHULRGHLV

1HWVQRHUYRRU]LFKWLJ

+DQWHHUKHWQHWVQRHUGRRUGHVWHNNHUYDVWWHQHPHQ7UHNGHVWHNNHU

QLHWORVGRRUDDQKHWVQRHUWHWUHNNHQHQUDDNKHWQHWVQRHUQRRLWDDQ

PHWQDWWHKDQGHQRPGDWKLHUGRRUNRUWVOXLWLQJRIHHQHOHNWULVFKVFKRN

YHURRU]DDNWNDQZRUGHQ3ODDWVKHWWRHVWHOHHQPHXEHOVWXNHQ]QLHW

RSKHWQHWVQRHUHQNOHPKHWVQRHUQLHWDI0DDNQRRLWNQRSHQLQKHW

QHWVQRHUHQNQRRSKHWQLHWYDVWDDQDQGHUHVQRHUHQ'HQHWVQRHUHQ

PRHWHQ]RJHOHJGZRUGHQGDWKHWQLHWZDDUVFKLMQOLMNLVGDWHURSJHORSHQ

NDQZRUGHQ(HQEHVFKDGLJGQHWVQRHUNDQEUDQGRIHHQHOHNWULVFKH

VFKRNYHURRU]DNHQ&RQWUROHHUKHWQHWVQRHU]RQXHQGDQ$OVX]LHW

GDWKHWQHWVQRHUEHVFKDGLJGLVYUDDJXZGLFKWVWELM]LMQGHHUNHQGH

VHUYLFHFHQWUXPRIXZYHUNRSHUGDQRPKHPWHYHUYDQJHQ

/(723

'LWDSSDUDDWLVJHFODVVL¿FHHUGDOVHHQNODVVHODVHUSURGXFWRQGHUGH

YHLOLJKHLGVQRUPHQYRRUODVHUSURGXFWHQ,(&

KLASSE 1 LASERPRODUCT

*HEUXLNHUVLQIRUPDWLHYRRUKHWYHU]DPHOHQHQYHU

ZLMGHUHQYDQRXGHSURGXFWHQHQEDWWHULMHQ

Symbolen

voor

batterijen

Symbool

voor

toestellen

'HV\PEROHQRSSURGXFWHQYHUSDNNLQJHQHQELMEHKRUHQGH

GRFXPHQWHQJHYHQDDQGDWGHJHEUXLNWHHOHNWURQLVFKHSURGXFWHQ

HQEDWWHULMHQQLHWPHWKHWJHZRQHKXLVKRXGHOLMNDIYDONXQQHQ

ZRUGHQVDPHQJHYRHJG

(UEHVWDDWHHQVSHFLDDOZHWWHOLMNYRRUJHVFKUHYHQYHU]DPHOV\VWHHP

YRRUGHMXLVWHEHKDQGOLQJKHWRSQLHXZEUXLNEDDUPDNHQHQGH

UHF\FODJHYDQJHEUXLNWHSURGXFWHQHQEDWWHULMHQ

'RRUHHQFRUUHFWHYHU]DPHOKDQGHOLQJ]RUJWXHUYRRUGDWKHW

YHUZLMGHUGHSURGXFWHQRIEDWWHULMRSGHMXLVWHZLM]HZRUGW

EHKDQGHOGRSQLHXZEUXLNEDDUZRUGWJHPDDNWZRUGWJHUHF\FOHHUG

HQKHWQLHWVFKDGHOLMNLVYRRUGHJH]RQGKHLGHQKHWPLOLHX

9RRUYHUGHUHLQIRUPDWLHEHWUHႇHQGHGHMXLVWHEHKDQGOLQJKHW

RSQLHXZEUXLNEDDUPDNHQHQGHUHF\FODJHYDQJHEUXLNWHSURGXFWHQ

HQEDWWHULMHQNXQWXFRQWDFWRSQHPHQPHWGHSODDWVHOLMNHRYHUKHLG

RIHHQYHUNRRSSXQW

'H]HV\PEROHQ]LMQHQNHOJHOGLJLQGHODQGHQYDQGHHXURSHVH

XQLH

,QGLHQX]LFKLQHHQDQGHUGDQERYHQJHQRHPGHODQGHQEHYLQGW

NXQWXFRQWDFWRSQHPHQPHWGHSODDWVHOLMNHRYHUKHLGYRRUPHHU

LQIRUPDWLHRYHUGHMXLVWHYHUZLMGHULQJYDQKHWSURGXFW

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Wat zit er in de doos

1. Hoofdtoestel (1)

2. Afstandsbediening (RC-980C) (1), batterijen (AAA/R03) (2)

3. Analoge Audiokabel (Voor testuitvoering) (1)

4. Netsnoer (1)

• Gebruiksaanwijzing (dit document) (1)

• Het netsnoer moet pas worden verbonden nadat alle andere kabels verbonden zijn.

• Wij zijn niet aansprakelijk voor enige schade als gevolg van de verbinding van apparatuur

die door andere bedrijven geproduceerd is.

• Specificaties en uiterlijk zijn zonder voorafgaande kennisgeving onderhevig aan

veranderingen.

De hoofdstroom kan niet in- of uitgeschakeld worden met de afstandsbediening. Gebruik de

knop 8 STANDBY/ON op het hoofdtoestel.

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Voorpaneel

Namen van de onderdelen

1. 8 STANDBY/ON-knop/controlelampje: Schakelt de netspanning van het toestel aan en

uit. Wanneer het toestel opgestart wordt, gaat het controlelampje in het midden van de

knop blauw branden.

2. STANDBY-controlelampje: Brandt rood wanneer het toestel in de stand-by-modus staat.

3. Disc-lade: Plaats hier discs. Er kunnen ook 8-cm discs gebruikt worden.

4. ;-knop: Open of sluit de disc-lade.

5. Afspeelknoppen:

u t : Ga terug naar het begin van het nummer dat afgespeeld wordt. Druk er opnieuw

om naar het nummer ervoor te gaan. Houd deze toets ingedrukt om het nummer snel

terug te spoelen.

/h : Afspelen of afspelen pauzeren.

y i : Als er tijdens het afspelen op gedrukt wordt, gaat men naar het volgende

nummer. Houd hem ingedrukt om het nummer verder te spoelen.

: Deze toets stopt afspelen.

6. Afstandsbedieningssensor

• Het signaalbereik van de afstandsbediening ligt binnen ongeveer 16'/5 m. met een

hoek van 20° ten opzichte van de loodrechte as en van 30° aan beide zijden.

7. CD/SACD-knop/controlelampje: Schakelt tussen CD/SACD als bron. Wanneer een

hybride SACD afgespeeld wordt, wordt de afgespeelde layer omgeschakeld als u tijdens

het afspelen hierop drukt. (P18)

Het controlelampje gaat blauw branden als SACD geselecteerd wordt.

8. DIRECT-knop/controlelampje: Schakelt de DIRECT-modus in en uit. (P15)

Het controlelampje gaat blauw branden als de DIRECT-modus op ON staat.

9. Display (P7)

10.

SOURCE-knop: Schakelt naar de af te spelen bron.

11.

SETUP-knop: Geeft het SETUP-menu weer. (P16)

6bkbl87 9

14352

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Achterpaneel

1. ANALOG OUT-aansluiting: Gebruik bijvoorbeeld een analoge audiokabel om een

geïntegreerde versterker aan te sluiten.

2. AC IN: Verbind het bijgeleverde netsnoer.

3. USB DAC-poort: Gebruik een USB-kabel (A-B type) om een computer te verbinden.

4. DIGITAL OUT OPTICAL/COAXIAL-aansluiting: Gebruik een digitale optische kabel of een

digitale coaxiale kabel om bijvoorbeeld een geïntegreerde versterker te verbinden.

5. CONTROL IN/OUT-aansluiting: Door versterkers van het merk Pioneer en audio-

apparaten te verbinden, is een gecentraliseerde bediening mogelijk. U kunt de

versterkers en de audio-apparaten bijvoorbeeld bedienen.

345

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Afstandsbediening

1. ^ STANDBY/ON-knop: Als de netvoeding van het toestel

ingeschakeld is, schakelt deze knop het toestel in of op

de stand-by-modus. De hoofdstroom kan niet in- of

uitgeschakeld worden met de afstandsbediening.

2. SHUFFLE-knop: Stelt willekeurig afspelen in. (P13)

3. REPEAT-knop: Stelt herhaald afspelen in. (P13)

4. Genummerde knoppen: Gebruikt om het tracknummer

van een muziek-CD rechtstreeks in te voeren wanneer

tracks geselecteerd worden. Wordt ook gebruikt om

tracknummers in te voeren voor programma afspelen.

5. CLEAR-knop: Wist de inhoud die ingesteld is voor

programma afspelen. (P13)

6. DIGITAL FILTER-knop: Selecteert een van de drie

soorten DIGITAL FILTER. (P15)

7. Cursorknoppen, ENTER-knop: Selecteer het item met de

cursorknoppen en druk op ENTER om te bevestigen.

8. SETUP-knop: Geeft het SETUP-menu weer. (P16)

9. Afspeelknoppen:

u : Terugkeer naar het begin van het nummer dat

afgespeeld wordt. Druk er opnieuw om naar het nummer

ervoor te gaan.

/h : Afspelen of afspelen pauzeren.

i : Ga naar het volgende nummer.

t : Indrukken en ingedrukt houden om de track die

afgespeeld wordt snel terug te spoelen.

g : Stop afspelen.

y : Indrukken en ingedrukt houden om de track die

afgespeeld wordt snel vooruit te spoelen.

10.

SOURCE-knop Schakelt naar de af te spelen bron.

11.DIRECT-knop: Schakelt de DIRECT-modus in en uit.

(P15)

12.

DISPLAY-knop: Verandert de informatie op het display.

• Afhankelijk van de bron zou de bediening mogelijk niet

van start gaan.

13.

; OPEN/CLOSE-knop: Opent of sluit de disc-lade.

14.

PROGRAM-knop: Gebruikt voor programma afspelen.

(P13)

15.

LOCK RANGE-knop: Geeft het instellingenscherm van

LOCK RANGE ADJUST weer. (P15)

16.

RETURN-knop: Zet het display terug naar de vorige

toestand.

17.

UP SAMPLING-knop: Zet de UP SAMPLING-functie ON

en OFF. (P15)

18.

CD/SACD-knop: Schakelt tussen CD/SACD als bron.

Wanneer een hybride SACD afgespeeld wordt, wordt de

afgespeelde layer omgeschakeld als u tijdens het

afspelen hierop drukt. (P18)

19.

DIGITAL OUT-knop: Schakelt de digitale uitgang op ON

en OFF. (P16)

20.

DISPLAY OFF-knop: Druk erop om het display van dit

toestel uit te schakelen. Druk er opnieuw op om het

display in te schakelen.

21.

DIMMER-knop: U kunt de helderheid van het display

regelen in drie stappen. (Standaardwaarde: Niveau 3)

bl bt

bm ck

Laat de polen met

elkaar samenvallen bij

het plaatsen van de

batterijen.

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Display

1. Brandt tijdens het afspelen van SACD en DSD.

2. Berichtendisplay: Geeft informatie weer over nummers en menu's.

3. Brandt wanneer handelingen met de cursorknoppen van de afstandsbediening mogelijk

zijn.

4. Toont de afspeelstatus.

5. Brandt wanneer de instelling van de digitale audio-uitgang ingeschakeld is. (P16)

6. Brandt wanneer items getoond worden zoals de resterende tijd voor een track van de disc

of de totale tijd van de disc.

7. Display wanneer een MQA-bestand of stream wordt afgespeeld. Raadpleeg

"MQA afspelen" voor meer informatie. (P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Verbindingen met een versterker

Installeren

Speel de audio af van discs die op dit toestel afgespeeld

worden en van apparaten die met dit toestel verbonden zijn

via luidsprekersystemen die verbonden zijn met

geïntegreerde versterkers of AV-ontvangers. Maak de

verbinding die past bij de ingangsaansluitingen op uw

versterker.

Verbinden met een analoge audiokabel

Het signaal wordt in de D/A-converter van dit toestel in

analoog omgezet en vervolgens naar bijvoorbeeld een

geïntegreerde versterker gezonden. Verbind de LINE IN-

aansluitingen op een geïntegreerde versterker met de

ANALOG OUT-aansluiting (RCA-aansluiting) op dit toestel.

Dit toestel

Geïntegreerde versterker, AV-ontvanger, enz.

a Analoge audiokabel

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Verbinden met een digitale optische kabel

Het signaal wordt in de D/A-converter van de geïntegreerde

versterker in analoog omgezet bijvoorbeeld. Verbind de

OPTICAL IN-aansluiting van een geïntegreerde versterker

aan de DIGITAL OUT OPTICAL-aansluiting op dit toestel.

• Het geluid van SACD en DSD of de invoer van USB DAC

wordt niet uitgevoerd vanaf de DIGITAL OUT OPTICAL-

aansluiting van dit toestel.

• De digitale signalen die door dit toestel uitgezonden

kunnen worden, zijn lineaire PCM-signalen met een

bemonsteringsfrequentie en een quantisatie bit-rate van

192 kHz/24 bit (de werking is misschien niet mogelijk met

alle verbonden apparaten of omgevingen).

Verbinden met een digitale coaxiale kabel

Het signaal wordt in de D/A-converter van de geïntegreerde

versterker in analoog omgezet bijvoorbeeld. Verbind de

COAXIAL IN-aansluiting van een geïntegreerde versterker

aan de DIGITAL OUT COAXIAL-aansluiting op dit toestel.

• Het geluid van SACD en DSD of de invoer van USB DAC

wordt niet uitgevoerd vanaf de DIGITAL OUT COAXIAL-

aansluiting van dit toestel.

• De digitale signalen die door dit toestel uitgezonden

kunnen worden, zijn lineaire PCM-signalen met een

bemonsteringsfrequentie en een quantisatie bit-rate van

192 kHz/24 bit (de werking is misschien niet mogelijk met

alle verbonden apparaten of omgevingen).

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

De bedieniningsaansluiting

Als u apparaten van meerdere Pioneer merken heeft en als

deze CONTROL IN/OUT aansluitingen hebben, kunt u deze

centraal besturen door middel van de

afstandsbedieningsensor op de versterker bijvoorbeeld.

Door verbinding te maken met de mono ministekkerkabels

(zonder resistors) zoals afgebeeld in het diagram, kunt u

zelfs als dit toestel en andere apparaten op plaatsen gezet

worden waar deze het afstandsbedieningsignaal niet

kunnen ontvangen, nog steeds de afstandsbedieningsensor

gebruiken om dit toestel of andere apparaten mee te

bedienen door de afstandsbediening te richten op de

afstandsbediening op de versterker bijvoorbeeld.

• Wees er tevens zeker van dat de verbinding met de

analoge audiokabel gemaakt wordt. De gecentraliseerde

bediening werkt mogelijk niet correct met alleen de

verbinding van de bedieningsaansluiting.

• De afstandsbedieningsensor op dit toestel stopt met

werken als u een mono ministekkerkabel (zonder

weerstand) met de CONTROL IN-aansluiting van dit

toestel verbindt.

• De afstandsbedieningsensoren op de andere apparaten

stoppen met werken als u een mono ministekkerkabel

(zonder weerstand) met de CONTROL OUT-aansluiting

van dit toestel verbindt.

• Als er een Pioneer merk-netwerk-speler en -versterker

verbonden wordt door de CONTROL IN/OUT-aansluiting,

kunt u basishandelingen uitvoeren op dit toestel, de

netwerkspeler en versterker op een smartphone app over

een netwerk.

(Een voorbeeld van verbinding)

CONTROL

OUT

CONTROL

OUT

Dit toestel

Versterker

Audio-

apparaat

a Mono ministekkerkabels (zonder weerstanden)

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Het netsnoer verbinden, enz.

1 2

Verbinding netsnoer

Dit model bevat een verwijderbaar netsnoer.

Het netsnoer moet pas worden aangesloten nadat alle

andere aansluitingen zijn voltooid. Zorg ervoor het netsnoer

eerst aan te sluiten op de AC IN-aansluiting van het toestel

en vervolgens op het stopcontact. Koppel altijd eerst de kant

van het stopcontact los wanneer u het netsnoer ontkoppelt.

Opstarten

Druk op het hoofdtoestel op 8 STANDBY/ON.

• Druk tijdens het opstarten erop, tot de knop naar binnen

gaat. Bij het opstarten van het toestel gaat het

8 STANDBY/ON-controlelampje in het midden van de

knop blauw branden.

a Netsnoer

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Discs afspelen

Afspelen

Raadpleeg (



P18) voor discs die u op dit toestel kunt afspelen.

Muziek-CD's afspelen

Voer de volgende procedure uit terwijl het toestel ingeschakeld is.

1. Druk op de afstandsbediening op CD/SACD om de bron

op CD/SACD te zetten.

2. Druk op het hoofdtoestel op ; om de disc-lade te openen

en druk, nadat de disc in de lade gelegd is, opnieuw op ;

om de lade te sluiten.

3. Druk op de afstandsbediening op /h (g) om het

afspelen te starten.

4. Gebruik afspeelknoppen (h) om het afspelen te stoppen of

nummers om af te spelen te kiezen. U kunt de selectie ook

uitvoeren door het tracknummer in te voeren met de

nummerknoppen (b). Als een tracknummer van 2 cijfers

ingevoerd wordt, druk dan net zo vaak op de +10-knop als de

waarde van het tweede cijfer (tienden) en druk vervolgens de

waarde van het eerste cijfer in. Als u op DISPLAY (d) drukt,

kunt u het display inschakelen om de verstreken tijd of de

resterende tijd van de disc te tonen, enz.

• De weergegeven inhoud is afhankelijk van de disc.

Een disc met muziekbestanden afspelen

Voer de volgende procedure uit terwijl het toestel ingeschakeld is.

1. Druk op de afstandsbediening op CD/SACD om de bron

op CD/SACD te zetten.

2. Druk op het hoofdtoestel op ; om de disc-lade te openen

en druk, nadat de disc in de lade gelegd is, opnieuw op ;

om de lade te sluiten.

3. Druk op de afstandsbediening op /h (g) om het

afspelen te starten.

4. Gebruik afspeelknoppen (h) om het afspelen te stoppen

of nummers om af te spelen te kiezen. Als u op DISPLAY

(d) drukt, kunt u het display inschakelen om de

verstreken tijd of de resterende tijd van de disc te tonen,

de bestandsnaam van de track of de tracknaam, enz.

• De weergegeven inhoud is afhankelijk van de disc en

het bestand.

• De weergave van de tracknaam wordt alleen

ondersteund met de formaten muziekbestanden MP3/

WMA/FLAC/AAC (alleen M4A)/DSD (alleen DSF).

• De tekens die niet op dit toestel weergegeven kunnen

worden, worden weergegeven als asterisken "".

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Herhaald afspelen

1. Druk herhaaldelijk op REPEAT (a) tijdens afspelen om

of op het display weer te geven.

: Herhaald afspelen van alle tracks.

: Herhaald afspelen van de track die afgespeeld wordt.

Om herhaald afspelen te annuleren, druk meerdere keren

op REPEAT (a) om op het display weer te geven.

Willekeurig afspelen

1. Druk op SHUFFLE (f) tijdens het afspelen of stoppen om

op het display weer te geven.

: Willekeurig afspelen van alle tracks.

Om gemengd afspelen te annuleren, druk op SHUFFLE

(f) om op het display weer te geven.

Programma afspelen

U kunt de volgorde selecteren waarmee tracks op een

muziek-CD afgespeeld worden.

1. Druk op PROGRAM (e) terwijl gestopt is.

"P00" wordt weergegeven als niets geregistreerd is. Voer

met de nummerknoppen (b) het tracknummer in dat u wilt

registreren. Als een tracknummer van 2 cijfers ingevoerd

wordt, druk dan net zo vaak op de +10-knop als de waarde

van het tweede cijfer (tienden) en druk vervolgens de

waarde van het eerste cijfer in. Het nummer in "P00" neemt

iedere keer dat u een track registreert toe. Er kunnen

maximaal 24 tracks geprogrammeerd worden.

• Druk op /h (g) op de afstandsbediening om het

geregistreerde programma af te spelen.

•

Als u op CLEAR (c) drukt terwijl tracks geregistreerd

worden, worden de tracks in volgorde gewist, te

beginnen met de track die het laatst geregistreerd werd.

• Als u op PROGRAM (e) drukt terwijl tracks

geregistreerd worden, worden alle tracks die u

geregistreerd heeft gewist.

• Als de totale speelduur van het geregistreerde

programma langer is dan 99 minuten 59 seconden,

wordt " : " op het display weer te geven.

ALL

OFF

Specificaties van bestanden die afgespeeld kunnen worden

* Bij het afspelen van bestanden die groter zijn dan 48 kHz moeten bestanden gebruikt worden die op een DVD-disc opgenomen zijn.

Opmerkingen over alle soorten bestanden

• Gebruik CD/CD-R/CD-RW discs die in overeenstemming zijn met de standaard ISO9660 niveau 1/niveau 2

bestandssysteem voor CD-ROM en die opgenomen zijn met gebruik van het systeem conform uitgebreide formattering

(Joliet en Romeo). Als DVD-discs gebruikt worden, gebruik dan naast bovenstaande discs de discs die opgenomen zijn

met gebruik van het UDF-bestandssysteem.

• De mapstructuur is beperkt tot acht niveaus en het maximum aantal tracks is 3000. Afhankelijk van de mapstructuur kan

het echter zijn dat niet alle mappen en tracks herkend en afgespeeld kunnen worden.

Opmerkingen over specifieke soorten bestanden

• Codeer WMA-bestanden met applicaties die gecertificeerd zijn door de Microsoft Corporation van de Verenigde Staten.

De werking kan mogelijk niet correct zijn als u niet-gecertificeerde applicaties gebruikt.

• Dit toestel ondersteunt het afspelen van AAC-bestanden met de extensie ".m4a" die gecodeerd zijn met gebruik van

iTunes. Het kan echter zijn dat afspelen niet mogelijk is als het bestand beveiligd is met DRM kopieerbeveiliging

(bescherming van het auteursrecht) of met bepaalde versies van iTunes die voor het coderen gebruikt werden.

• WAV-bestanden bevatten ongecomprimeerde PCM digitale audio.

• AIFF-bestanden bevatten ongecomprimeerde PCM digitale audio.

Bemonsteringsfrequentie

Bitsnelheden

Kwantiseringsbit

Soorten discs die afgespeeld kunnen worden

Extensie

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44,1/48 kHz

Tussen 8 kbps en

320 kbps en VBR.

–.mp3

WMA 44,1/48 kHz

Tussen 5 kbps en

192 kbps en VBR.

–.wma

AAC 44,1/48/88,2/96 kHz

Tussen 8 kbps en

320 kbps en VBR.

–

.aac/

.m4a

WAV

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.wav

AIFF

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.aif/

.aiff

FLAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.flac

ALAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bit

.m4a

DSD 2,8/5,6 MHz – 1 bit –

.dsf/

.dff

MQA

44,1/48/88,2/96/176,4/

192/352,8/384 kHz

– 8/16/24 bit

.flac/

.wav

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Dit toestel als D/A-converter gebruiken

U kunt de digitale audio van de PC op dit toestel naar

analoog converteren en vervolgens uitvoeren vanaf de

ANALOG OUT-aansluitingen.

Naar de bron schakelen

1. Druk op SOURCE van dit toestel of de

afstandsbediening om de bron van het apparaat te

schakelen naar “USB DAC”.

Aansluitingen

2. Gebruik een USB-kabel type A-B om een computer te

verbinden.

Afspelen

3. Start het afspelen op de speler.

• De digitale signalen die door dit toestel uitgezonden

kunnen worden, zijn lineaire PCM-signalen met een

bemonsteringsfrequentie en een quantisatie bit-rate van

48 kHz/32 bit (de werking is misschien niet mogelijk met

alle verbonden apparaten of omgevingen).

• De ondersteunde besturingssystemen van de PC zijn

Windows10

en Mac OS X.

• Bij andere besturingssystemen dan de ondersteunde,

kan het geluid worden onderbroken of niet worden

weergegeven.

• Afhankelijk van de gebruiksomgeving wordt het afspelen

mogelijk niet normaal uitgevoerd.

USB DAC

a USB-kabel

> Vóór het Starten > Namen van de onderdelen > Installeren >Afspelen

Geavanceerde Setup | Overige

Aanpassen van geluidskwaliteit

Reproduceert getrouw het oorspronkelijke

geluid (DIRECT-modus)

Processen die van invloed op de geluidskwaliteit zijn

worden afgesloten waardoor een geluid geproduceerd

wordt dat zich dichter bij het originele geluid bevindt.

(Standaardwaarde): OFF

1. Druk op DIRECT (d).

• Het DIRECT-controlelampje op de voorkant van het

hoofdtoestel brandt terwijl de DIRECT-modus ON is.

• Als de DIRECT-modus ON is, is DIGITAL OUT op OFF

gezet.

• In de DIRECT-modus, wordt het display automatisch

uitgeschakeld tijdens het afspelen van CD of SACD, of

wanneer USB DAC is verbonden.

• Wanneer u tijdens het afspelen van instelling verandert,

kan het geluid worden onderbroken.

DIGITAL FILTER

Selecteert een van de drie soorten DIGITAL FILTER.

1. De instelling verandert iedere keer wanneer u op

DIGITAL FILTER (a) drukt.

"SLOW": Zacht en vloeibaar geluid

"SHARP" (Standaardwaarde): Geluid met meer structuur

en stevigheid

"SHORT": Geluid dat snel begint en vooruit lijkt te

bewegen

• U kunt ook op SETUP (c) drukken om het

instellingenscherm voor DIGITAL FILTER weer te geven

van uit het SETUP-menu. Selecteer de waarde van de

instelling in dit geval met / (b) op de

afstandsbediening.

• De instelling is vastgesteld op “SHORT” tijdens het

afspelen van MQA-CD of een schijf die muziekbestanden

bevat of bij gebruik van USB DAC.

• Wanneer u tijdens het afspelen van instelling verandert,

kan het geluid worden onderbroken.

UP SAMPLING

De vergroting van de bemonsteringsfrequentie helpt om

een geluidsweergave met een hoge mate van helderheid te

verkrijgen.

(Standaardwaarde) : OFF

1. U kunt ook drukken op UP SAMPLING (g) om de functie

ON en OFF te zetten.

• Deze functie kan niet worden gebruikt wanneer de

DIRECT-modus is ingesteld op ON of tijdens het

afspelen van SACD of DSD.

• De instelling is vastgesteld op "ON" tijdens het afspelen

van MQA-CD of een schijf die muziekbestanden bevat of

bij gebruik van USB DAC.

• Wanneer u tijdens het afspelen van instelling verandert,

kan het geluid worden onderbroken.

De lock range aanpassen

(LOCK RANGE ADJUST)

De geluidskwaliteit wordt verbeterd door de lock range te

versmallen zodat er minder incidentele geluiden zullen zijn.

Als de lock range echter te smal wordt kunnen

onderbrekingen van het geluid en ruis veroorzaakt worden.

Pas de lock range aan terwijl u naar het geluid luistert.

(Standaardwaarde): RANGE 6

1. Druk op LOCK RANGE (e).

2. Selecteer de instellingswaarde met / (f) op de

afstandsbediening.

"RANGE 6" (breed) tot "RANGE 1" (smal)

• U kunt ook op SETUP (c) drukken om het

instellingenscherm voor LOCK RANGE ADJUST weer te

geven van uit het SETUP-menu.

• De instelling is vastgesteld op "6" tijdens het afspelen

van MQA-CD of een schijf die muziekbestanden bevat of

bij gebruik van USB DAC.

• LOCK RANGE ADJUST is niet van invloed op de audio

van SACD en DSD.

• Wanneer u tijdens het afspelen van instelling verandert,

kan het geluid worden onderbroken.

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Geavanceerde instellingen

Geavanceerde Setup

Het toestel stelt u in staat geavanceerde instellingen te

configureren om u een nog betere ervaring te laten beleven.

1. Druk op de afstandsbediening op SETUP.

2. Selecteer de inhoud of de instelling met de

cursorknoppen op de afstandsbediening en druk op

ENTER om uw selectie te bevestigen. Om terug te keren

naar het vorige scherm, druk op RETURN.

3. Druk op SETUP om de instellingen te verlaten.

AUTO STANDBY

Deze instelling zet de unit automatisch op stand-by na 20

minuten inactiviteit zonder audio-invoer.

"ON" (Standaardwaarde): Het toestel zal automatisch naar

de stand-by-modus gaan.

"OFF": Het toestel zal niet automatisch naar de stand-by-

modus gaan.

POWER ON PLAY

U kunt het zo instellen dat de disc automatisch begint af te

spelen wanneer dit toestel ingeschakeld wordt.

• Door een extern verbonden automatische timer te

gebruiken, kunt u afspelen volgens de timer wanneer de

stroom automatisch ingeschakeld wordt.

"ON": Om discs automatisch af te spelen

"OFF" (Standaardwaarde): Als geen disc afgespeeld

moeten worden

DIGITAL OUT

Maak instellingen voor digitale audio-uitgave. Als geen

verbinding gemaakt wordt met de DIGITAL OUT OPTICAL/

COAXIAL-aansluiting, kunt u naar nog helderder audio

luisteren door dit op OFF te zetten.

"ON" (Standaardwaarde), "OFF"

DIGITAL FILTER

U kunt het type DIGITAL FILTER selecteren. (P15)

UP SAMPLING

De vergroting van de bemonsteringsfrequentie helpt om

een geluidsweergave met een hoge mate van helderheid te

verkrijgen. (P15)

LOCK RANGE ADJUST

De lock range aanpassen. (P15)

LOADING MODE

De laadtijd voor een CD kan worden ingekort.

• Door deze functie te activeren, kan de laadtijd worden

verkort, afhankelijk van de CD, het geluid kan echter

overslaan aan het begin van het afspelen.

"NORMAL" (Standaardwaarde): Wanneer de laadtijd voor

CD niet is ingekort

"FAST": Wanneer de laadtijd voor de CD is ingekort

AUTO STANDBY

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Problemen oplossen

Overige

Alvorens de procedure te starten

Wanneer bediening onstabiel is, kunnen problemen

opgelost worden door simpelweg de stroom aan te zetten of

op stand-by te zetten of het netsnoer eruit/erin te doen,

i.p.v. instellingen en bedieningen na te kijken. Probeer de

eenvoudige maatregelen op zowel de unit als het

aangesloten apparaat. Als het probleem niet opgelost wordt

na raadpleging van "Problemen oplossen", kan het

probleem verholpen worden door het toestel te resetten

naar de status die het had op het moment van verzending.

Het resetten van het toestel (hierdoor worden de

instellingen van het toestel op de

standaardwaarden gereset)

1. Met ingeschakelde stroom en terwijl geen disc geplaatst

is, houd u op het hoofdtoestel g ingedrukt en drukt u op

DIRECT.

2. "CLEAR" wordt weergegeven, het toestel schakelt naar

stand-by en de instellingen worden gereset.

■ Voeding

Kan het toestel niet inschakelen

• Trek de stekker van het netsnoer uit het stopcontact,

wacht 2 minuten of langer en steek de stekker weer in

het stopcontact.

Het apparaat schakelt onverwachts uit

• Het toestel schakelt automatisch naar stand-by als de

instelling "AUTO STANDBY" in het SETUP-menu werkt.

Het STANDBY-controlelampje op het hoofdtoestel gaat

door met rood knipperen en de bediening is niet mogelijk

• Trek de stekker van het netsnoer uit het stopcontact,

wacht 2 minuten of langer en steek de stekker weer in

het stopcontact. het controlelampje blijft knipperen maar

druk op het hoofdtoestel op 8 STANDBY/ON om de

netstroom op ON te zetten. Als dit het probleem niet

verhelpt, kan het om een storing gaan. Trek de stekker

uit het stopcontact en neem contact op met de verkoper

of onze klantendienst.

■ Het display wordt niet verlicht

• Het is mogelijk dat het display uitgeschakeld werd toen

op DISPLAY OFF gedrukt werd. Druk op DISPLAY OFF

om het display in te schakelen.

■ Kan geen discs afspelen

• Plaats de disc zo in de laden dat het etiket naar boven wijst.

• Afpelen zou niet mogelijk kunnen zijn als de disc krassen

heeft of vuil is.

• Geluidsbestanden die worden beschermd door het

auteursrecht kunnen niet worden afgespeeld.

• De disclade gaat open als u een disc plaatst die niet door

dit toestel ondersteund wordt.

■ Audio

Geluid wordt onderbroken

• Als de lock range te smal wordt met de instelling van LOCK

RANGE ADJUST kunnen onderbrekingen van het geluid

en kan ook ruis veroorzaakt worden. Onderbrekingen van

het geluid die veroorzaakt worden door aanpassingen van

de lock range worden niet door onze garantie van de

werking gedekt. Luister ergens naar terwijl u de lock range

aanpast.

Er is geen digitaal geluid

• Zet "DIGITAL OUT" in het SETUP-menu op "ON".

• Het geluid van SACD en DSD of de invoer van USB DAC

is geen digitale uitvoer.

■ Afstandsbediening

• Zorg ervoor dat de batterijen met de polen in de juiste

richting zijn geplaatst.

• Plaats nieuwe batterijen. Gebruik geen verschillende

soorten batterijen of nieuwe en oude batterijen door elkaar.

• Zorg ervoor dat dit toestel niet wordt blootgesteld aan

direct zonlicht of TL-verlichting van het type inverter.

Verplaats indien nodig.

• Als dit toestel is geïnstalleerd in een rek of kast met

gekleurde glazen deuren, of als de deuren gesloten zijn,

zal de afstandsbediening mogelijk niet goed werken.

■ D/A-converterfunctie

• Controleer of de apparaten correct verbonden zijn.

• Speel audio af die compatibel is met de

ingangsaansluitingen op dit toestel. (P14)

Kan geen audio afkomstig van computers afspelen

• Annuleer de geluidsdemping op uw computer.

• Selecteer dit toestel in de instellingen voor het uitzenden

van audio op uw computer. Als de bron van dit apparaat

op iets anders staat dan “USB DAC”, kan de PC dit

apparaat niet detecteren.

• Als er meerdere applicaties op de computer werkzaam

zijn, sluit dan de applicaties af die u niet gebruikt.

De bemonsteringsfrequentie is altijd dezelfde via de

USB DAC-ingang

• Afhankelijk van de computerinstellingen en zelfs als de

bemonsteringsfrequenties van de afgespeelde bestanden

verschillend zijn, worden ze geconverteerd in dezelfde

bemonsteringsfrequentie om uitgezonden te worden.

Computergeluiden anders dan muziek worden via de

USB DAC-ingang uitgezonden.

• Afhankelijk van de instellingen op de computer worden

geluiden zoals de opstarttoon of foutgeluiden via dit

toestel afgespeeld.

■ SACD

• Wegens de verschillende opnamemethoden kan er

verschil in volume zijn tussen SACD en CD.

CLEAR

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Overige opmerkingen

■ Discs die afgespeeld kunnen worden

Voorzorgsmaatregelen voor het afspelen

• Er kunnen compact discs (CD's) met het volgende logo

op het etiket gebruikt worden.

• Houd er rekening mee dat sommige discs mogelijk niet

kunnen worden afgespeeld wegens de kenmerken van

de disc, krassen, vuil of de opnamestatus.

MQA afspelen

Dit toestel omvat de MQA (Master Quality Authenticated) -

technologie voor het afspelen van MQA audiobestanden en

streams, waarbij het geluid van de originele masteropname

wordt geleverd.

Dit apparaat is een CD-speler die een MQA-CD kan

herkennen. De ingebouwde MQA-decoder herstelt het hoge-

resolutiesignaal dat in de studio wordt gehoord en bevestigt

dit met behulp van de authenticatiesignatuur.

Bezoek www.mqa.co.uk/customer/mqacd voor meer

informatie.

‘MQA’ of ‘MQA.’ geeft aan dat het product een MQA-stream

of -bestand decodeert en afspeelt om ervoor te zorgen dat het

geluid identiek is aan dat van het bronmateriaal. ‘MQA.’ geeft

aan dat het een MQA Studio-bestand afspeelt, dat ofwel in de

studio is goedgekeurd door de kunstenaar/producent ofwel is

geverifieerd door de eigenaar van het auteursrecht.

Afspelen van hybride SACD

Hybride SACD's bestaan uit twee layers; de SACD-layer en

de CD-layer. Druk op CD/SACD om de layer te selecteren

waarnaar u wilt luisteren.

DualDisks afspelen

"DualDisk" is een disc waarvan op de ene zijde de video en

de audio voldoen aan de DVD-standaard en op de andere

zijde de audio op een CD-speler kan worden afgespeeld.

Op de audiozijde die niet de DVD-zijde is, is afspelen

misschien niet altijd mogelijk wegens het feit dat de disc niet

in overeenstemming is met de fysieke specificaties van

standaard-CD's.

Bediening tijdens het afspelen

Rechtstreeks zoeken werkt niet tijdens het afspelen van

dics met muziekgegevens.

Disctypen die niet op dit toestel afgespeeld

kunnen worden

DVD Video, DVD Audio, CD-G, Video CD, DTS-CD

Opmerkingen over discs

• Pas op dat uw hand of uw vingers niet vast komen te

zitten wanneer de disklade geopend of gesloten wordt.

• Gebruik nooit discs die een ongebruikelijke vorm hebben

(zoals hartvormige of achthoekige discs). Deze soorten

discs kunnen vastlopen en het toestel schade berokkenen.

• Sommige audio-CD's met een kopieerbeveiligingsfunctie

komen niet overeen met de officiële normen voor CD's.

Dit zijn speciale discs en kunnen niet door dit toestel

worden afgespeeld.

• Gebruik geen discs met resten cellofaan erop, gehuurde

discs met afgebladderde etiketten of discs met decoratieve

etiketten. Dit type disc kan vast komen te zitten in het toestel

of kan het toestel schade berokkenen.

• Laat een disc met een etiket dat door een inkjet printer

afgedrukt is nooit lange tijd in het toestel zitten. De disc

kan vast komen te zitten in het toestel of kan het toestel

schade berokkenen.

■ Reinigen van de speler

• Gewoonlijk hoeft u de speler slechts schoon te vegen

met een zachte doek. Hardnekkig vuil kunt u weg

poetsen met een zachte doek met wat neutrale zeep in

5 tot 6 delen water, stevig uitgewrongen, om daarna

zorgvuldig na te drogen met een zachte droge doek.

•

Gebruik geen spiritus, thinner, benzeen of insecticide op

de speler, want dergelijke middelen kunnen de afwerking

aantasten. Laat ook niet langdurig plastic of rubber

voorwerpen tegen de speler aan liggen, want ook dat kan

de afwerking aantasten.

•

Bij gebruik van een chemisch reinigingsdoekje e.d. dient

u de gebruiksaanwijzing daarvan zorgvuldig te lezen.

• Wanneer stof op de schijflade moeilijk te verwijderen is,

breng dan plakband, enz. aan om het stof te verwijderen.

■ Voorzorgsmaatregelen bij het verplaatsen

van het toestel

Als het toestel verplaatst wordt, verwijder dan eerst iedere

disc die erin zit en sluit de disc-lade. Druk vervolgens op het

hoofdtoestel op 8 STANDBY/ON, wacht 10 seconden

nadat [OFF] van het display verdwenen is en trek

vervolgens de stekker van het netsnoer uit het stopcontact.

Als het toestel verplaatst wordt terwijl er nog steeds een

disc in zit, kan dit schade veroorzaken.

■ Condensvorming

Er kunnen waterdruppels binnenin het toestel ontstaan als

het van een koude plaats naar een warme ruimte

meegenomen wordt of als een koude ruimte snel verwarmd

wordt door een verwarming. Dit wordt condens genoemd.

Dit kan niet alleen een slechte werking van het toestel

veroorzaken maar ook de disc of onderdelen van het toestel

schade berokkenen. Wij raden aan de discs uit het toestel

te halen als het toestel een poosje niet gebruikt zal worden.

Als de mogelijkheid bestaat dat condens opgetreden is, trek

het netsnoer dan los en laat het toestel minstens 3 uur op

kamertemperatuur.

MQA-CD

SACD (Super Audio CD)

(alleen 2-kanaalszone)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen

Geavanceerde Setup | Overige

Algemene specificaties

■ Analoge audio-uitgang

Nominaal uitgangsniveau en impedantie

• RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100 

Frequentie reactie

• CD: 2 Hz - 20 kHz,

SACD: 2 Hz - 50 kHz (-3 dB)

Signaal/ruis-verhouding

• CD: 116 dB of meer (A-weging),

SACD: 116 dB of meer (A-weging)

THD+N

• CD: 0,002 % of minder,

SACD: 0,002 % of minder

■ Digitale audio-ingang

USB DAC

• Type B, USB Audioklasse 1.0

■ Digitale audio-uitgang

Coaxiale digitale uitgang

• RCA-aansluiting, 0,5 Vp-p / 75 

Optische digitale uitgang

• Optische aansluiting, -14 - -21 dBm / 660 nm

■ Overige

Ingaande bediening

• Ø3,5 mini-aansluiting (mono)

Uitgaande bediening

• Ø3,5 mini-aansluiting (mono)

■ Algemeen

Voeding

• AC 220 - 230 V, 50/60 Hz

Stroomverbruik

•43W

• 0,3 W (In Stand-by)

AUTO STANDBY

• ON (20 min) / OFF

Afmetingen (B  D  H)

• 435 mm  138 mm  413 mm

Gewicht

• 13,1 kg

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

SUPER AUDIO CD PLAYER

PD-50AE

Grundläggande

bruksanvisning

Innan du börjar

Säkerhetsinformation .............................................................. 2

Vad som finns i förpackningen ................................................ 3

Delarnas namn

Frontpanel .............................................................................. 4

Bakpanel ................................................................................. 5

Fjärrkontroll ............................................................................. 6

Display .................................................................................... 7

Installera

Anslutningar till en förstärkare ................................................ 8

Att ansluta nätkabeln, etc. .....................................................11

Uppspelning

Spela upp skivor ................................................................... 12

Att använda den här apparaten som en D/A-omvandlare ..........14

Att justera ljudkvaliteten ........................................................ 15

Avancerade inställningar

Avancerade inställningar ....................................................... 16

Övrigt

Felsökning ............................................................................ 17

Andra anmärkningar:............................................................. 18

Allmänna specifikationer........................................................ 19

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Säkerhetsinformation

Innan du börjar

WARNING

RISK OF ELECTRIC SHOCK

DO NOT OPEN

RISQUE DE CHOC ELECTRIQUE

NE PAS OUVRIR

AVIS

%OL[WSLOHQLQRPHQOLNVLGLJWULDQJHOlUDYVHGGDWWYDUQD

DQYlQGDUHQRPDWWGHW¿QQVRLVROHUDG³IDUOLJVSlQQLQJ´LQXWL

DSSDUDWHQVRPNDQYDUDWLOOUlFNOLJWVWDUNI|UDWWJHHOHNWULVND

VW|WDUPHGSHUVRQVNDGRUVRPI|OMG

8WURSVWHFNQHWLQRPHQOLNVLGLJWULDQJHOlUDYVHGGDWWSnPLQQD

DQYlQGDUHQRPDWWGHW¿QQVYLNWLJDDQYlQGQLQJVRFK

XQGHUKnOOVDQYLVQLQJDULOLWWHUDWXUHQVRPPHGI|OMHUDSSDUDWHQ

2%6(59(5$

$9/b*61$,17(+g/-(7(//(5%$.6,'$1'c'(7),1165,6.

)g5(/(.75,6.67g7'(7),116,1*$'(/$5620.$16(59$6

$9$19b1'$5(1,187,(1+(7(1g9(5/c76(59,&(7,//%(+g5,*

6(59,&(3(5621$/

9$51,1*

$9/b*61$,17(+g/-(7(//(5%$.6,'$1'c'(7),116

5,6.)g5(/(.75,6.67g7'(7),116,1*$'(/$5620.$1

6(59$6$9$19b1'$5(1,187,(1+(7(1g9(5/c76(59,&(

7,//%(+g5,*6(59,&(3(5621$/

'HQQDXWUXVWQLQJlULQWHYDWWHQWlW3ODFHUDGlUI|ULQWHQnJRQEHKnOODUH

PHGYlWVNDLQlUKHWHQDYXWUXVWQLQJHQVRPWH[HQYDVHOOHU

EORPNUXND8WVlWWLQWHKHOOHUXWUXVWQLQJHQI|UGURSSDQGHVNYlWWDQGH

UHJQHOOHUIXNWGnGHW¿QQVULVNI|UEUDQGRFKHOVW|W

3ODFHUDLQJD|SSQDOnJRUVRPWH[HWWWlQWOMXVSnXWUXVWQLQJHQGnGHW

¿QQVULVNI|UEUDQG

$QYlQGLQWHHOOHUI|UYDUDLQWHEDWWHULHULGLUHNWVROOMXVHOOHUSnDQGUD

|YHUGULYHWYDUPDSODWVHUVnVRPLQXWLHQELOHOOHULQlUKHWHQDYHQ

YlUPDUH'HWWDNDQOHGDWLOODWWEDWWHULHUQDOlFNHU|YHUKHWWDVH[SORGHUDU

HOOHUE|UMDUEULQQD'HWNDQlYHQPLQVNDEDWWHULHUQDVOLYVOlQJGHOOHU

SUHVWDQGD

)|UYDUDVPnGHODUXWRPUlFNKnOOI|UEDUQ2PGHVYlOMVDYPLVVWDJ

PnVWHHQOlNDUHJHQDVWXSSV|NDV

'HW¿QQVOXFNRURFK|SSQLQJDUI|UYHQWLODWLRQLSURGXNWHQVK|OMHI|UDWW

JDUDQWHUDWLOOI|UOLWOLJGULIWRFKI|UDWWI|UKLQGUD|YHUKHWWQLQJgSSQLQJDUQD

E|UDOGULJEORFNHUDVHOOHUWlFNDVDYI|UHPnOH[HPSHOYLVWLGQLQJDU

ERUGVGXNDUJDUGLQHUGnGHWWD|NDUEUDQGULVNHQ3URGXNWHQE|ULQWH

KHOOHUDQYlQGDVSnHQWMRFNPDWWDHOOHULHQVlQJ

2PEDWWHULHWE\WVXWPRWHWWDYIHOW\S¿QQVGHWHQULVNI|UH[SORVLRQ'HW

¿QQVHQULVNI|UH[SORVLRQRPHWWEDWWHULERUWVNDႇDVLHOGHOOHUHQKHW

XJQHOOHUNURVVDVPHNDQLVNWHOOHURPEDWWHULHWVNlUVXSS

)|UVLNWLJKHWVnWJlUGHU

2PDSSDUDWHQSODFHUDVLHQP|EHOWLOOH[HPSHOLHQERNK\OODHOOHULHQ

VWHUHRElQNVnVHWLOODWWWLOOUlFNOLJYHQWLODWLRQWLOOJRGRVHV

6HWLOODWWOlPQDHWWXWU\PPHSnPLQVWFPRYDQI|URFKSnVLGRUQDDY

DSSDUDWHQRFKSnPLQVWFPEDNRPDSSDUDWHQ'HQEDNUHNDQWHQSn

K\OODQHOOHUVNLYDQRYDQI|UDSSDUDWHQE|UYDUDSODFHUDGPLQVWFP

IUnQDSSDUDWHQVEDNVLGDHOOHUYlJJHQI|UDWWVNDSDHWWPHOODQUXPJHQRP

YLONHWYDUPOXIWNDQVWU|PPDXW

'ULIWVPLOM|

'ULIWVPLOM|QVWHPSHUDWXURFKOXIWIXNWLJKHW&WLOO&)WLOO

)PLQGUHlQUHODWLYOXIWIXNWLJKHWOXIWLQWDJHMEORFNHUDGH

,QVWDOOHUDLQWHHQKHWHQLHWWGnOLJWYHQWLOHUDWXWU\PPHHOOHUSnSODWVHU

VRPXWVlWWVI|UK|JOXIWIXNWLJKHWHOOHUGLUHNWVROOMXVHOOHUVWDUNDUWL¿FLHOO

EHO\VQLQJ

9LNWLJWPHGGHODQGH

0RGHOORFKVHULHQXPUHWSnGHQKlUXWUXVWQLQJHQVLWWHUEDNWLOOHOOHU

XQGHUWLOO1RWHUDGHVVDQXPPHUSnGHWPHGI|OMDQGHJDUDQWLNRUWHWRFK

I|UYDUDGHWSnHQVlNHUSODWVI|UIUDPWLGDEUXN

9$5)g56,.7,*

6WU|PEU\WDUNQDSSHQSnGHQKlUDSSDUDWHQNRPPHULQWHDWWVWlQJD

DYDOOVWU|PIUnQYlJJXWWDJHWKHOW(IWHUVRPQlWNDEHOQDQYlQGVVRP

KXYXGVDNOLJIUnQVNLOMDUHI|UGHQQDHQKHWNRPPHUGXEHK|YDNRSSODERUW

QlWNDEHOQIUnQYlJJXWWDJHWI|UDWWVWlQJDDYDOOVWU|P'lUI|UPnVWHGX

VHWLOODWWHQKHWHQKDULQVWDOOHUDWVVnDWWQlWNDEHOQOlWWNDQNRSSODVERUW

IUnQYlJJXWWDJHWYLGRO\FNRU)|UDWWXQGYLNDEUDQGULVNE|UQlWNDEHOQ

GHVVXWRPNRSSODVERUWIUnQYlJJXWWDJHWQlUHQKHWHQOlPQDVRDQYlQG

XQGHUHQOnQJWLGWLOOH[HPSHOQlUGXlUERUWDSnVHPHVWHU

'HQQDSURGXNWlUWLOOI|UDOOPlQQDKXVKnOOVlQGDPnO(YHQWXHOODIHOVRP

XSSVWnUSnJUXQGDYDQQDQDQYlQGQLQJVRPWH[OnQJWLGVDQYlQGQLQJ

LNRPPHUVLHOOWV\IWHLHQUHVWDXUDQJHOOHUDQYlQGQLQJLHQELOHOOHUSnHQ

EnWRFKVRPPnVWHUHSDUHUDVGHELWHUDVlYHQXQGHUJDUDQWLSHULRGHQ

)|UVLNWLJKHWPHGHONDEHOQ

+DQWHUDQlWNDEHOQPHGKMlOSDYVWLFNNRQWDNWHQ'UDLQWHXWNRQWDNWHQ

JHQRPDWWU\FNDLNDEHOQRFKU|UDOGULJQlWNDEHOQQlUGLQDKlQGHUlU

YnWDHIWHUVRPGHWWDVNXOOHNXQQDOHGDWLOONRUWVOXWQLQJHOOHUHOHNWULVNVW|W

3ODFHUDLQWHHQKHWHQHQGHODYHQP|EHOHWFSnQlWNDEHOQRFKQ\S

LQWHWLOONDEHOQ*|UDOGULJHQNQXWSnNDEHOQRFKELQGLQWHLKRSGHQPHG

DQGUDNDEODU1lWNDEODUQDE|UOlJJDVVnDWWGHWLQWHlUWUROLJWDWWQnJRQ

JnUSnGHP(QVNDGDGQlWNDEHONDQOHGDWLOOEUDQGHOOHUJHGLJHQ

HOHNWULVNVW|W.RQWUROOHUDQlWNDEHOQPHGMlPQDPHOODQUXP1lUGXVHU

DWWGHQlUVNDGDGVNDGXEHYnUWQlUPDVWHDXNWRULVHUDGHVHUYLFHFHQWHU

HOOHUGLQnWHUI|UVlOMDUHDWWE\WDXWGHQ

9$5)g56,.7,*

'HQKlUSURGXNWHQlUNODVVDGVRPNODVVODVHUSURGXNWXQGHU/DVHU

6lNHUKHW,(&

KLASS 1-LASERPRODUKT

,QIRUPDWLRQWLOODQYlQGDUHDYVHHQGHLQVDPOLQJRFK

KDQWHULQJDYXWWMlQWXWUXVWQLQJRFKI|UEUXNDGH

EDWWHULHU

Symbol

batterier

Symbol

produkter

1lUGHQQDV\PERO¿QQVSnSURGXNWHUI|USDFNQLQJDURFKHOOHU

PHGI|OMDQGHGRNXPHQWLQQHElUGHWWDDWWI|UEUXNDGHOHNWULVNRFK

HOHNWURQLVNXWUXVWQLQJRFKEDWWHULHULQWHInUEODQGDVPHGYDQOLJW

KXVKnOOVDYIDOO

)|UEHK|ULJEHKDQGOLQJnWHUYLQQLQJRFKnWHUDQYlQGQLQJDYXWWMlQWD

SURGXNWHURFKI|UEUXNDGHEDWWHULHUYlQOLJHQOlPQDGHVVDSnKlUI|U

DYVHGGDXSSVDPOLQJVSODWVHULHQOLJKHWPHGQDWLRQHOOODJVWLIWQLQJ

*HQRPDWWDYIDOOVKDQWHUDGHVVDSURGXNWHURFKEDWWHULHUSnHWW

NRUUHNWVlWWELGUDUGXWLOODWWVN\GGDYlUGHIXOODUHVXUVHURFK

I|UKLQGUDIUDPWLGDSRWHQWLHOODQHJDWLYDHႇHNWHUSnPlQQLVNRUV

KlOVDRFKYnUPLOM|YLONDLDQQDWIDOONDQNRPPDDWW|NDWLOOI|OMGDY

RWLOOE|UOLJDYIDOOVKDQWHULQJ

)|UPHULQIRUPDWLRQRPLQVDPOLQJRFKnWHUYLQQLQJDYXWWMlQWD

SURGXNWHURFKEDWWHULHUYlQOLJHQNRQWDNWDGLQNRPPXQORNDO

DYIDOOVLQVDPOLQJHOOHUGHQEXWLNGlUGXN|SWSURGXNWHUQD

'HVVDV\PEROHUlUHQGDVWJLOWLJDLQRP(XURSHLVND8QLRQHQ

:(((

KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Vad som finns i förpackningen

1. Huvudapparat (1)

2. Fjärrkontroll (RC-980C) (1), Batterier (AAA/R03) (2)

3. Analog Ljudkabel (För testoperation) (1)

4. Nätkabel (1)

• Bruksanvisning (det här dokumentet) (1)

• Nätkabeln får inte anslutas innan alla andra kabelanslutningar har slutförts.

• Vi kommer inte att ta något ansvar för skador som uppstår på grund av anslutning av

utrustning som tillverkats av andra företag.

• Specifikationer och utseende kan ändras utan föregående meddelande.

Det går inte att sätta på eller stänga av huvudströmmen med fjärrkontrollen. Använd

8 STANDBY/ON-knappen på huvudapparaten.

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Frontpanel

Delarnas namn

1. 8 STANDBY/ON-knapp/indikator: Sätter på och stänger av huvudströmmen till

apparaten. När apparaten startas, lyser indikatorn i mitten av knappen blått.

2. STANDBY-indikator: Lyser rött när apparaten är i standbyläget.

3. Skivfack: Placera skivan här. Det går även att använda 8 cm-skivor.

4. ;-knappen: Öppnar eller stänger skivfacket.

5. Spela-knappen:

u t : Går tillbaka till början av det spår som spelas. Tryck på den igen för att gå

tillbaka till föregående spår. Tryck och håll ned för att spola tillbaka spåret snabbt.

: Spela eller pausa uppspelningen.

y i : Går till nästa spår, om du trycker på den under uppspelning. Tryck och håll kvar

för att snabbspola genom spåret.

: Den här knappen stoppar uppspelningen.

6. Fjärrkontrollsensor

• Fjärrkontrollens mottagningsområde är inom ett avstånd på ungefär 16´/5 m och en

vinkel på 20° i vertikal riktning och 30° till höger och vänster.

7. CD/SACD-knapp/indikator: Växla mellan cd/sacd som källa. När man spelar upp en

hybrid-sacd, ändras lagret som spelas om du trycker på denna vid uppspelning. (P18)

Indikatorlampan lyser blått när du valt sacd.

8. DIRECT-knapp/indikator: Växlar DIRECT-läget mellan av och på. (P15)

Indikatorn lyser blått när DIRECT-läget är ON.

9. Display (P7)

10.

SOURCE-knappen: Ändrar vilken källa som ska spelas.

11.

SETUP-knappen: Visar SETUP-menyn. (P16)

6bkbl87 9

14352

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Bakpanel

1. ANALOG OUT-uttag: Använd en analog audiokabel för att ansluta en integrerad

förstärkare, t.ex.

2. AC IN: Anslut den medföljande nätkabeln.

3. USB DAC-port: Använd en usb-kabel (A-B typ) för att ansluta till en dator.

4. DIGITAL OUT OPTICAL/COAXIAL-uttag: Använda en digital optisk kabel eller en digital

koaxialkabel för att t.ex. ansluta en integrerad förstärkare.

5. CONTROL IN/OUT-uttag: Om du ansluter förstärkare och ljudenheter av märket Pioneer

är centraliserad styrning möjlig. Till exempel kan du styra förstärkarna och ljudenheterna.

345

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Fjärrkontroll

1. ^ STANDBY/ON-knapp: När huvudströmmen till

apparaten är på, sätter den här på apparaten eller sätter

den i standbyläge. Det går inte att sätta på eller stänga

av huvudströmmen med fjärrkontrollen.

2. SHUFFLE-knappen: Ställer in blandad uppspelning.

(P13)

3. REPEAT-knappen: Ställer in upprepad uppspelning.

(P13)

4. Sifferknappar: Använd dessa för att direkt skriva in

spårnummer på en musik-cd när du väljer spår. Används

också för att skriva in spårnummer vid programmerad

uppspelning.

5. CLEAR-knappen: Radera innehållet som ställts in för

programmerad uppspelning. (P13)

6. DIGITAL FILTER-knappen: Välj en av de tre typerna

DIGITAL FILTER. (P15)

7. Markörknappar, ENTER-knapp: Välj alternativet med

markörknapparna och tryck på ENTER för att bekräfta.

8. SETUP-knappen: Visar SETUP-menyn. (P16)

9. Spela-knappen:

u : Går tillbaka till början av det spår som spelas. Tryck

på den igen för att gå tillbaka till föregående spår.

/h : Spela eller pausa uppspelningen.

i : Gå till nästa spår.

t : Tryck och håll kvar för att snabbspola bakåt genom

spåret medan det spelas.

g : Stoppa uppspelningen.

y : Tryck och håll kvar för att snabbspola framåt genom

spåret medan det spelas.

10.

SOURCE-knappen: Ändrar vilken källa som ska spelas.

11.DIRECT-knappen: Växlar DIRECT-läget mellan av och

på. (P15)

12.

DISPLAY-knappen: Växlar informationen på displayen.

• Beroende på källan, kanske funktionen inte startar.

13.

; OPEN/CLOSE-knappen: Öppnar eller stänger

skivfacket.

14.

PROGRAM-knappen: Används för programmerad

uppspelning. (P13)

15.

LOCK RANGE-knappen: Visar LOCK RANGE ADJUST-

inställningsskärmen. (P15)

16.

RETURN-knappen: Tryck för att gå tillbaka till den

föregående inställningen.

17.

UP SAMPLING-knapp: Slå ON (på) och OFF (av) UP

SAMPLING -funktionen. (P15)

18.

CD/SACD-knapp: Växla mellan cd/sacd som källa. När

man spelar upp en hybrid-sacd, ändras lagret som

spelas om du trycker på denna vid uppspelning. (P18)

19.

DIGITAL OUT-knappen: Växlar den digitala utgången

mellan av och på. (P16)

20.

DISPLAY OFF-knappen: Tryck på den för att stänga av

displayen på den här apparaten. Tryck på den igen för att

sätta på displayen.

21.

DIMMER-knappen: Du kan justera displayens ljusstyrka i

tre steg. (Standardvärde: nivå 3)

bl bt

bm ck

När du sätter i

batterierna ska du se till

att polariteten matchar.

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Display

1. Tänds vid uppspelning av sacd och DSD.

2. Meddelandedisplay: Visar information om spår och menyer.

3. Tänds när det går att använda markörknapparna på fjärrkontrollen.

4. Visar uppspelningsstatus.

5. Tänds när den digitala ljudutgångsinställningen är på. (P16)

6. Tänds när alternativ som kvarvarande tid för ett spår eller en skiva, eller den totala tiden

för skivan visas.

7. Display när en MQA-fil eller -ström spelas. För detaljer, se "Spela MQA". (P18)

DSD

DIGITAL

TOTAL REMAIN

52 63 4

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Anslutningar till en förstärkare

Installera

Spela ljudet från skivor som spelas upp på den här

apparaten och från enheter som är anslutna till den här

apparaten genom högtalarsystem anslutna till integrerade

förstärkare eller AV-mottagare. Anslut så att de passa

ingångsuttagen på din förstärkare.

Ansluta med en analog ljudkabel

Signalen konverteras till analog i den här apparatens D/A-

omvandlare och skickas sedan t.ex. ut till den integrerade

förstärkaren. Anslut LINE IN-uttagen på den integrerade

förstärkaren till den här apparatens ANALOG OUT-uttag

(RCA-uttag).

Den här enheten

Integrerad förstärkare, AV-receiver, etc.

a Analog ljudkabel

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Ansluta med en digital optisk kabel

Signalen konverteras till analog i den integrerade

förstärkarens D/A-omvandlare t.ex. Anslut OPTICAL IN-

uttaget på en integrerad förstärkare till DIGITAL OUT

OPTICAL-uttaget i denna enhet.

• Audio från sacd och DSD eller input från USB DAC

matas inte ut från DIGITAL OUT OPTICAL-uttaget på

denna enhet.

• De digitala signalerna som kan matas ut av den här

apparaten är linjära PCM-signaler med en

samplingsfrekvens och kvantiseringsbithastighet på

192 kHz/24 bitar (det kanske inte fungerar med alla

anslutna enheter eller i alla miljöer).

Ansluta med en digital koaxialkabel

Signalen konverteras till analog i den integrerade

förstärkarens D/A-omvandlare t.ex. Anslut COAXIAL IN-

uttaget i en integrerad förstärkare till DIGITAL OUT

COAXIAL-uttaget i denna enhet.

• Audio från sacd och DSD eller input från USB DAC

matas inte ut från DIGITAL OUT COAXIAL-uttaget på

denna enhet.

• De digitala signalerna som kan matas ut av den här

apparaten är linjära PCM-signaler med en

samplingsfrekvens och kvantiseringsbithastighet på

192 kHz/24 bitar (det kanske inte fungerar med alla

anslutna enheter eller i alla miljöer).

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Styruttaget

Om du har flera enheter av märket Pioneer och om de har

CONTROL IN/OUT-uttag, kan du kontrollera dem centralt

via förstärkarens fjärrkontrollsensor, till exempel. Genom att

ansluta med mono-miniplugkablar utan resistorer (se

diagram), kan du använda fjärrkontrollen för att styra den

här och andra enheter, även om de befinner sig på platser

där de inte kan ta emot fjärrkontrollens signal, genom att

rikta fjärrkontrollen mot förstärkarens fjärrkontrollsensor till

exempel.

• Se också till att ansluta med den analoga ljudkabeln.

Centraliserad styrning fungerar inte korrekt om du endast

använder styruttagsanslutningen.

• Fjärrkontrollsensorn på denna enhet slutar fungera om

du ansluter en mono-miniplugkabel (utan resistor) till

CONTROL IN uttaget på denna enhet.

• Fjärrkontrollsensorerna på övriga enheter slutar fungera

om du ansluter en mono-miniplugkabel (utan resistor) till

CONTROL OUT -uttaget på denna enhet.

• Om en nätverksspelare och förstärkare av märket

Pioneer ansluts via CONTROL IN/OUT-uttaget kan du

styra grundfunktionerna på denna enhet,

nätverksspelaren och förstärkaren med en smartphone-

app över ett nätverk.

(Ett exempel på anslutning)

CONTROL

OUT

CONTROL

OUT

Den här enheten

Förstärkare

Ljudenhet

a Monominikontaktkablar (utan resistorer)

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Att ansluta nätkabeln, etc.

1 2

Anslutning av nätkabeln

Denna modell har en löstagbar nätkabel.

Nätkabeln får inte anslutas innan alla andra anslutningar är

slutförda. Se till att du först ansluter nätkabeln till AC IN-

uttaget på apparaten och anslut den sedan till ett eluttag.

Koppla alltid loss nätkabeln från vägguttaget först när kabeln

ska kopplas loss.

Starta

Tryck på 8 STANDBY/ON på huvudenheten.

• När du ska starta apparaten, trycker du tills knappen går

in. När apparaten startar, lyser 8 STANDBY/ON-

indikatorn i mitten av knappen blått.

a Nätkabel

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Spela upp skivor

Uppspelning

Se (P18) för info om skivor du kan spela på den här

apparaten.

Spela musik-cd:ar

Utför följande procedur när apparaten är på.

1. Tryck på CD/SACD på fjärrkontrollen för att ställa in

källan på cd/sacd.

2. Tryck på ; på huvudapparaten för att öppna skivfacket,

och efter att skivan satts i facket, trycker du på ; igen för

att stänga facket.

3. Tryck på /h (g) på fjärrkontrollen för att starta

uppspelningen.

4. Använd uppspelningsknapparna (h) för att stoppa

uppspelningen eller för att välja spår att spela upp. Du

kan också välja genom att skriva in spårnumret med

sifferknapparna (b). När du skriver in ett 2-siffrigt

spårnummer, trycker du på +10-knappen lika många

gånger som värdet på den andra siffran (tiotal), och

sedan trycker du in värdet för den första siffran. Om du

trycker på DISPLAY (d), kan du växla visningen mellan

att visa förfluten tid eller kvarvarande tid av skivan etc.

• Vilket innehåll som visas beror på skivan.

Spela en skiva med musikfiler

Utför följande procedur när apparaten är på.

1. Tryck på CD/SACD på fjärrkontrollen för att ställa in

källan på cd/sacd.

2. Tryck på ; på huvudapparaten för att öppna skivfacket,

och efter att skivan satts i facket, trycker du på ; igen för

att stänga facket.

3. Tryck på /h (g) på fjärrkontrollen för att starta

uppspelningen.

4. Använd uppspelningsknapparna (h) för att stoppa

uppspelningen eller för att välja spår att spela upp. Om

du trycker på DISPLAY (d), kan du växla visningen

mellan att visa förfluten tid, kvarvarande tid på skivan,

spårets filnamn eller spårets namn, etc.

• Vilket innehåll som visas beror på skivan och filen.

• Visning av spårets namn stöds för endast för musikfiler

i formaten MP3/WMA/FLAC/AAC (endast M4A)/DSD

(endast DSF).

• Tecken som inte kan visas på den här apparaten visas

som "".

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Upprepad uppspelning

1. Tryck på REPEAT (a) flera gånger under uppspelning för

att visa eller på displayen.

: Upprepa uppspelningen av alla spår.

: Upprepa uppspelningen av spåret som spelas.

För att avbryta repeterad avspelning, tryck på REPEAT

(a) ett flertal gånger för att visa på displayen.

Blandad uppspelning

1. Tryck på SHUFFLE (f) under avspelning eller stopp för att

visa på displayen.

: Spelar upp alla spår slumpmässigt.

För att avbryta slumpmässig avspelning, tryck på

SHUFFLE (f) för att visa på displayen.

Programmerad uppspelning

Du kan välja vilken ordning spåren på en musik-cd spelas

upp i.

1. Tryck på PROGRAM (e) när den stoppats.

"P00” visas när det inte registrerats något. Skriv

spårnumret du vill registrera med sifferknapparna (b). När

du skriver in ett 2-siffrigt spårnummer, trycker du på

+10-knappen lika många gånger som värdet på den

andra siffran (tiotal), och sedan trycker du in värdet för

den första siffran. Spårnumret i "P00" ökar varje gång du

registrerar ett spår. Det går att registrera upp till 24 spår.

• Tryck på /h (g) på fjärrkontrollen för att spela upp det

registrerade programmet.

• Om du trycker på CLEAR (c) medan du registrerar

spår, raderas spåren i ordning, med början från det

spår du registrerade senast.

• Om du trycker på PROGRAM (e) medan du registrerar

spår, raderas alla spår du registrerat.

• Om den totala avspelningstiden för det registrerade

programmet överstiger 99 minuter och 59 sekunder, så

visas " : " på displayen.

ALL

OFF

Specifikationer på filer som kan spelas upp

* Använd filer som spelats in på en dvd-skiva när filer som överskrider 48 kHz spelas upp.

Anmärkningar om alla filtyper

• Använd cd/cd-r/cd-rw-skivor som följer standarden ISO9660 nivå 1/nivå 2 på cd-rom-filsystemet och som är inspelad med

systemet som överensstämmer med utökad formatering (Romeo och Julia). När du använder dvd-skivor ska du, förutom

ovanstående, använda skivor som spelats in med filsystemet UDF.

• Mappstrukturen är begränsad till åtta nivåer och det maximala antalet spår är 3000. Men, beroende på mappstrukturen,

kanske det inte går att hitta och spela alla mappar och spår.

Anmärkningar om särskilda filtyper

• Koda WMA-filer med hjälp av program som certifierats av Microsoft Corporation i USA. Funktionerna kanske inte fungerar

som de ska om du använder program som inte certifierats.

• Den här apparaten stöder uppspelning av AAC-filer med filändelsen ".m4a" som har kodats med iTunes. Men det kanske

inte går att spela upp den om filen skyddats med kopieringsskyddet DRM (upphovsrättsskydd) eller när vissa versioner av

iTunes använts vid kodningen.

• WAV-filer innehåller okomprimerat PCM digitalt ljud.

• AIFF-filer innehåller okomprimerat digitalt PCM-ljud.

Samplingsfrekvenser

Bithastigheter

Kvantiseringsbit

Typer av skivor som kan spelas upp

Filändelse

CD-R/

CD-RW

DVD-R/

DVD-RW

DVD+R/

DVD+RW

MP3 44,1/48 kHz

Mellan 8 kbit/s och

320 kbit/s och VBR.

–.mp3

WMA 44,1/48 kHz

Mellan 5 kbit/s och

192 kbit/s och VBR.

–.wma

AAC 44,1/48/88,2/96 kHz

Mellan 8 kbit/s och

320 kbit/s och VBR.

–

.aac/

.m4a

WAV

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bitar

.wav

AIFF

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bitar

.aif/

.aiff

FLAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bitar

.flac

ALAC

44,1/48/88,2/96/

176,4/192 kHz

– 8/16/24 bitar

.m4a

DSD 2,8/5,6 MHz – 1 bitar –

.dsf/

.dff

MQA

44,1/48/88,2/96/176,4/

192/352,8/384 kHz

– 8/16/24 bitar

.flac/

.wav

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Att använda den här apparaten som en D/A-omvandlare

Du kan konvertera digital audio från datorn till analog på

denna enhet och sedan mata ut den från ANALOG OUT-

uttaget.

Ändra källa

1. Tryck på SOURCE på denna enhet eller på

fjärrkontrollen för att skifta källan på enheten till “USB

DAC”.

Anslutningar

2. Använd en usb-kabel av A-B typ för att ansluta till en

dator.

Uppspelning

3. Starta uppspelning från spelaren.

• De digitala signalerna som kan matas in i den här

apparaten är linjära PCM-signaler med en

samplingsfrekvens och kvantiseringsbithastighet på

48 kHz/32 bitar (det kanske inte fungerar med alla

anslutna enheter eller i alla miljöer).

• Operativsystem som stöds i dator för anslutning är

Windows10

och Mac OS X.

• Med andra operativsystem kan ljudet avbrytas eller inte

matas ut alls.

• Beroende på omgivningen kan det hända att avspelning

inte kan utföras normalt.

USB DAC

a usb-kabel

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Att justera ljudkvaliteten

Att återge det ursprungliga ljudet

verklighetstroget (DIRECT-läge)

Bearbetning som påverkar ljudkvaliteten stängs av så att

ljudet som återges är närmare originalet.

(Standardvärde): OFF

1. Tryck på DIRECT (d).

• DIRECT-Indikatorn på framsidan av huvudapparaten

tänds när DIRECT-läget är ON.

• När DIRECT-läget är ON, ställs DIGITAL OUT in på OFF.

• I DIRECT-läge, så slocknar displayen automatiskt när

man spelar cd eller sacd, eller ansluter USB DAC.

• När man skiftar inställningen under avspelning kan det

hända att audio avbryts.

DIGITAL FILTER

Välj en av de tre typerna DIGITAL FILTER.

1. Inställningen ändras varje gång du trycker på DIGITAL

FILTER (a).

"SLOW": Mjukt och flytande ljud

"SHARP" (Standardvärde): Ljud med mer struktur och

fasthet

"SHORT": Ljud som startar snabbt och verkar röra sig

framåt

• Du kan också trycka på SETUP (c) för att visa DIGITAL

FILTER-inställningsskärmen via SETUP-menyn. I så fall

väljer du värdet som ska ställas in med / (b) på

fjärrkontrollen.

• Inställningen är fixerad till "SHORT" när man spelar

MQA-CD eller en skiva med musikfiler, eller använder

USB DAC.

• När man skiftar inställningen under avspelning kan det

hända att audio avbryts.

UP SAMPLING

Att utöka samplingsfrekvensen gör att det blir lättare att

återge ljud med högre klarhet.

(Standardvärde) : OFF

1. Du kan även trycka på UP SAMPLING (g) för att slå ON

(på) och OFF (av) funktionen.

• Denna funktion kan inte användas när DIRECT-läget är

ON (på) eller under avspelning av sacd eller DSD.

• Inställningen är fixerad till "ON" när man spelar MQA-CD

eller en skiva med musikfiler, eller använder USB DAC.

• När man skiftar inställningen under avspelning kan det

hända att audio avbryts.

Justera låsomfånget

(LOCK RANGE ADJUST)

Ljudkvaliteten förbättras genom att begränsa låsomfånget

så att oförutsedda ljud minskas. Men om man begränsar

låsomfånget för mycket, kan det orsaka avbrott i ljudet och

brus. Justera låsomfånget samtidigt som du lyssnar på

ljudet.

(Standardvärde): RANGE 6

1. Tryck på LOCK RANGE (e).

2. Välj inställningsvärde med / (f) på fjärrkontrollen.

"RANGE 6" (bred) till "RANGE 1" (smal)

• Du kan också trycka på SETUP (c) för att visa LOCK

RANGE ADJUST-inställningsskärmen via SETUP-

menyn.

• Inställningen är fixerad till "6" när man spelar MQA-CD

eller en skiva med musikfiler, eller använder USB DAC.

• LOCK RANGE ADJUST har ingen effekt på sacd- och

DSD-ljudet.

• När man skiftar inställningen under avspelning kan det

hända att audio avbryts.

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar |Övrigt

Avancerade inställningar

Enheten gör det möjligt för dig att konfigurera avancerade

inställningar för att ge dig en ännu bättre erfarenhet.

1. Tryck på SETUP på fjärrkontrollen.

2. Välj innehållet eller inställningen med markörerna på

fjärrkontrollen och tryck på ENTER för att bekräfta ditt

val. Återgå till föregående skärmbild genom att trycka på

RETURN.

3. Tryck på SETUP, för att lämna inställningarna.

AUTO STANDBY

Denna inställning sätter automatiskt enheten i standby-läge

efter 20 minuters inaktivitet utan någon ljudinmatning.

"ON" (Standardvärde): Enheten går automatiskt in i

standbyläge.

"OFF": Enheten går inte automatiskt in i standbyläge.

POWER ON PLAY

Du kan ställa in den så att skivan automatiskt börjar spela

upp när den här apparaten sätts på.

• Genom att använda en externt ansluten auto-timer, kan

du använda timeruppspelning när strömmen sätts på

automatiskt.

"ON": Att spela upp skivor automatiskt

"OFF" (Standardvärde): När skivor inte ska spelas upp

DIGITAL OUT

Gör inställningarna för digital ljudutmatning. När du inte

ansluter till DIGITAL OUT OPTICAL/COAXIAL-uttaget, kan

du lyssna på ännu klarare ljud genom att ställa in det på

OFF.

"ON" (Standardvärde), "OFF"

DIGITAL FILTER

Du kan välja typ av DIGITAL FILTER. (P15)

UP SAMPLING

Att utöka samplingsfrekvensen gör att det blir lättare att

återge ljud med högre klarhet. (P15)

LOCK RANGE ADJUST

Justera låsomfånget. (P15)

LOADING MODE

Laddningstiden för cd kan förkortas.

• Aktivering av denna funktion tillåter att laddningstiden

förkortas beroende på cd: n, men ljudet kan emellertid

hoppa i början av avspelningen.

“NORMAL” (Standardvärde): När laddningstiden för cd inte

är förkortad

“FAST”: När laddningstiden för cd är förkortad

AUTO STANDBY

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Felsökning

Övrigt

Innan du startar proceduren

När en funktion är instabil, kan problemet lösas genom att

helt enkelt sätta på strömmen, sätta den i standby eller dra

ur/sätta i nätkabeln, hellre än att gå igenom inställningarna

och funktionerna. Testa de enkla åtgärderna på både

enheten och den anslutna utrustningen. Om problemet inte

avhjälps efter att ha gått igenom "Felsökning", kan en

återställning av apparaten, till samma status som vid

leveransen, lösa problemet.

Återställ den här apparaten (detta återställer

apparatens inställningar till

standardinställningarna)

1. När strömmen är på och det inte sitter någon skiva i,

trycker du på DIRECT medan du trycker på och håller

kvar g på huvudapparaten.

2. ”CLEAR” visas, apparaten går över i standby och

inställningarna återställs.

■ Ström

Kan inte slå på enheten

• Dra ut nätkabeln ur vägguttaget, vänta minst 2 minuter

och sätt sedan i den igen.

Enheten stängs av oväntat

• Apparaten går automatiskt i standby när inställningen är

"AUTO STANDBY"-inställningen i SETUP-menyn är

aktiv.

STANDBY-indikatorn på huvudapparaten fortsätter att

blinka rött och det går inte att använda den

• Dra ut nätkabeln ur vägguttaget, vänta minst 2 minuter

och sätt sedan i den igen. Indikatorn kommer att fortsätta

att blinka, men tryck på 8 STANDBY/ON på

huvudapparaten för att strömmen ska stå på ON. Om

detta inte löser problemet kan det ha uppstått ett

funktionsfel. Dra ur nätkabeln ur vägguttaget och

kontakta återförsäljaren eller vår kundsupport.

■ Displayen tänds inte

• Det är möjligt att displayen har stängts av genom att man

tryckt på DISPLAY OFF. Tryck på DISPLAY OFF för att

sätta på displayen.

■ Det går inte att spela skivor

• Lägg i skivan i facket med etiketten uppåt.

• Det kanske inte går att spela skivan om den är repig eller

smutsig.

• Ljudfiler som skyddas av upphovsrätt kan inte spelas

upp.

• Skivfacket öppnas om du sätter i en skiva som inte stöds

av den här apparaten.

■ Audio

Ljudet avbryts

• Om man begränsar låsomfånget för mycket med LOCK

RANGE ADJUST-inställningen, kan det orsaka avbrott i

ljudet och även orsaka brus. Avbrott i ljudet som orsakas

av justeringen av låsomfånget täcks inte av vår

funktionsgaranti. Lyssna på ljudet medan du justerar

låsomfånget.

Det hörs inget digitalt ljud

• Ställ in "DIGITAL OUT" i SETUP-menyn på "ON".

• Audio från sacd och DSD eller input från USB DAC

matas inte ut digitalt.

■ Fjärrkontroll

• Se till att batterierna sitter åt rätt håll.

• Sätt i nya batterier. Blanda inte olika typer av batterier,

eller gamla och nya batterier.

• Se till att den här apparaten inte utsätts för direkt solljus

eller lysrörsljus av invertertyp. Flytta vid behov.

• Om den här apparaten installeras på en hylla eller i ett

skåp med färgade glasdörrar eller om dörrarna är

stängda kanske fjärrkontrollen inte fungerar korrekt.

■ Funktioner för D/A-omvandlare

• Se till att enheterna är korrekt anslutna.

• Spela upp ljud som är kompatibelt med ingångarna på

den här apparaten. (P14)

Kan inte spela upp ljud från datorer

• Avbryt ljudavstängningen på din dator.

• Välj den här apparaten i ljudutgångsinställningarna på

din dator. Om källan för denna enhet är ställd till något

annat än “USB DAC”, så kan datorn inte detektera denna

enhet.

• Om det är flera program i gång på datorn, avslutar du de

du inte använder.

Samplingsfrekvensen är alltid densamma genom USB

DAC-ingången

• Beroende på datorns inställningar, konverteras de till

samma samplingsfrekvens för utmatning, även om

samplingsfrekvensen för de filer som spelas upp är olika.

Andra datorljud än musiken hörs genom USB DAC-

ingången

• Beroende på datorns inställningar kan ljud som datorns

startljud eller ljud vid felmeddelanden spelas upp genom

den här apparaten.

■ SACD

• På grund av skillnaderna i inspelningsmetoderna, kan det

finnas en skillnad i volymen mellan en sacd och en cd.

CLEAR

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Andra anmärkningar:

■ Skivor som kan spelas upp

Försiktighetsåtgärder vid uppspelning

• Det går att använda cd-skivor (cd:ar) med följande logo

på etikettytan.

• Observera att vissa skivor kanske inte kan spelas upp på

grund av skivans egenskaper, repor, smuts eller

inspelningstillståndet.

Spela MQA

Denna enhet inkluderar MQA-teknologi (Master Quality

Authenticated), vilket tillåter avspelning av MQA audiofiler

och strömmar, vilket levererar ljudet från den ursprungliga

masterinspelningen.

Denna enhet är en cd-spelare som kan avläsa en MQA-CD.

Den inbyggda MQA-avkodaren kommer att återställa den

högupplösta signalen som hörs i studion och bekräfta den

med hjälp av autentiseringssignaturen. Gå till

www.mqa.co.uk/customer/mqacd för mer information.

‘MQA’ eller ‘MQA.’ indikerar att produkten avkodar och spelar

en MQA-ström eller -fil, samt och betecknar härkomst för att

säkerställa att ljudet är identiskt med källmaterialet. ‘MQA.’

indikerar att den spelar en MQA Studio-fil, vilken antingen

har godkänts i studion av artisten/producenten eller har

verifierats av upphovsrättsinnehavaren.

Spela hybrid-sacd

Hybrid-sacd:ar består av två lager; sacd-lagret och cd-

lagret. Tryck på CD/SACD för att välja det lager du vill

lyssna på.

Spela upp DualDisks

"DualDisk" är en skiva med film och ljud som följer dvd-

standarden på en sida, och ljud som kan spelas på en cd-

spelare på den andra.

Ljudsidan, som inte är dvd-sidan, kanske inte alltid går att

spela upp på grund av att skivan inte följer de fysiska

specifikationerna för standard-cd:ar.

Funktioner vid uppspelning

Direkt sökning fungerar inte medan man spelar upp skivor

med musikdata.

Typer av skivor som inte kan spelas upp på den

här apparaten

Dvd video, dvd audio, cd-g, video cd, DTS-CD

Anmärkningar om skivor

• Var försiktig så att du inte handen kommer i vägen när du

öppnar och stänger skivfacket.

• Använd aldrig skivor som har en ovanlig form (som

hjärtan eller oktogoner). Den här typen av skivor kan

fastna och skada apparaten.

• Vissa ljud-cd:ar med funktioner för kopieringsskydd, följer

inte officiella cd-standarder. Dessa speciella typer av

skivor kan inte spelas upp med den här apparaten.

• Använd inte skivor med rester av cellofantejp, hyrskivor

med etiketter som har dragits av, eller skivor med

dekorativa etiketter. Den här typen av skivor kan fastna i

enheten eller skada enheten.

• Lämna inte en skiva med en etikett som skrivits ut på en

bläckstråleskrivare i apparaten under en längre tid.

Skivan kan fastna i apparaten eller skada apparaten.

■ Rengöra spelaren

• Normalt torkar du av spelaren med en mjuk trasa. Om

smutsen sitter hårt, kan du använda ett neutralt

rengöringsmedel utspätt med 5 till 6 delar vatten på en

mjuk trasa. Vrid ur den ordentligt, torka av smutsen, och

torka sedan igen med en torr trasa.

•

Observera att om man får alkohol, thinner, bensen eller

insektsmedel på spelaren kan det göra att tryck och

beläggnings skalas av. Undvik också att lämna gummi-

eller vinylprodukter i kontakt med spelaren under en

längre period, eftersom det kan skada höljet.

• Om du använder trasor eller liknade med kemiska

impregneringsmedel ska produktens varningstext läsas noga.

• När det är svårt att avlägsna damm i skivfacket, använd

en bit tejp etc. för att avlägsna dammet.

■ Försiktighetsåtgärder när den här

apparaten flyttas

Ta bort ev. skivor och stäng skivfacket när den här

apparaten ska flyttas. Tryck sedan på 8 STANDBY/ON på

huvudapparaten, vänta i 10 sekunder efter att [OFF]

försvunnit från displayen och dra sedan ut nätkabeln. Om

man flyttar apparaten medan det fortfarande sitter en skiva

i, kan det orsaka skador.

■ Kondensering

Det kan bildas vattendroppar inuti den här apparaten om

den flyttas från en kall plats till ett varmt rum eller när ett

kallt rum värms upp snabbt med värmeelement. Det kallas

kondensering. Det kan inte bara orsaka att apparaten

krånglar, utan det kan även skada skivan eller delar av

apparaten. Vi rekommenderar att du tar bort skivor från

apparaten om den inte ska användas på ett tag. Om det

finns en risk för att det bildats kondens, drar du ur nätkabeln

och låter apparaten stå i minst 3 timmar i rumstemperatur.

MQA-CD

Sacd (Super Audio CD)

(Endast 2-kanalsområde)

CD, CD-R, CD-RW

DVD-R, DVD-R (DL), DVD-RW

DVD+R, DVD+R (DL), DVD+RW

> Innan du börjar > Delarnas namn > Installera > Uppspelning

Avancerade inställningar | Övrigt

Allmänna specifikationer

■ Analog ljudutmatning

Nominell utnivå och impedans

• RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100 

Frekvensgång

• CD: 2 Hz - 20 kHz,

SACD: 2 Hz - 50 kHz (-3 dB)

Signal-/brusforhallande

• CD: 116 dB eller mer (A-vägning),

SACD: 116 dB eller mer (A-vägning)

THD+N

• CD: 0,002 % eller mindre,

SACD: 0,002 % eller mindre

■ Digital Audio-ingång

USB DAC

• Typ B, USB Ljudklass 1.0

■ Digital ljudutmatning

Koaxial digitalutgång

• RCA-uttag, 0,5 Vp-p / 75 

Optisk digitalutgång

• Optiskt uttag, -14 - -21 dBm / 660 nm

■ Övrigt

Styrning in

• Ø3,5 miniuttag (mono)

Styruttag

• Ø3,5 miniuttag (mono)

■ Allmänt

Strömförsörjning

• 220 - 230 V AC, 50/60 Hz

Strömförbrukning

•43W

• 0,3 W (I standby)

AUTO STANDBY

• ON (20 min) / OFF

Mått (B  H  D)

• 435 mm  138 mm  413 mm

Vikt

• 13,1 kg

License and Trademark Information

Licence et marque commerciale

Licencias y marcas comerciales

Licenza e dei marchi

Lizenz- und Warenzeichen

Licentie en handelsmerken

Licens och varumärke

MQA and the Sound Wave Device are registered trade marks of MQA Limited.

"Super Audio CD" is a registered trademark.

DSD and the Direct Stream Digital logo are trademarks of Sony Corporation.

Windows 10, Windows Media, and the Windows logo are trademarks or

registered trademarks of Microsoft Corporation in the United States and/or other

countries.

macOS is a trademark of Apple Inc., registered in the U.S. and other countries.

All other trademarks are the property of their respective owners. / Toutes les

autres marques commerciales sont la propriété de leurs détenteurs respectifs. /

El resto de marcas comerciales son propiedad de sus respectivos propietarios.

/ Tutti gli altri marchi di fabbrica sono di proprietà dei rispettivi proprietari. / Alle

anderen Warenzeichen sind das Eigentum ihrer jeweiligen Eigentümer. / Alle

andere handelsmerken zijn eigendom van de desbetreffende rechthebbenden. /

Alla andra varumärken tillhör deras respektive ägare.

Important Notice Regarding Software

The software package installed in this product includes software licensed to Onkyo & Pioneer Corporation (hereinafter,

called "O&P Corporation") directly or indirectly by third party developers. Please be sure to read this notice regarding

such software.

ソフトウェアに関する重要なお知らせ

本製品に搭載されるソフトウェアには、オンキヨー & パイオニア株式会社 ( 以下「弊社」とします ) が第三者

より直接的に又は間接的に使用の許諾を受けたソフトウェアが含まれております。これらのソフトウェアに関

する本お知らせを必ずご一読くださいますようお願い申し上げます。

Notice Regarding GNU GPL/LGPL-applicable Software

This product includes the following software that is covered by GNU General Public License (hereinafter, called "GPL")

or by GNU Lesser General Public License (hereinafter, called "LGPL"). O&P Corporation notifies you that, according

to the attached GPL/LGPL, you have right to obtain, modify, and redistribute software source code for the listed

software.

GNU GPL / LGPL 適用ソフトウェアに関するお知らせ

本製品には、以下の GNU General Public License( 以下「GPL」とします ) または GNU Lesser General Public

License( 以下「LGPL」とします ) の適用を受けるソフトウェアが含まれております。お客様は添付の GPL/

LGPL に従いこれらのソフトウェアソースコードの入手、改変、再配布の権利があることをお知らせいたしま

す。

Package List / パッケージリスト

bash-3.2.57 coreutils-6.9 e2fsprogs-1.41.14-482 findutils-4.2.31

gawk-3.1.5 gdb-6.6 glibc-2.18 gzip-1.3.12

libmtp-1.1.6 libusb-1.0.9 libusb-compat-0.1.4 Linux kernel-3.10.26

module-init-tools-3.12 mtd-utils-1 ntfsprogs-2.0.0-482 procps-3.2.8

psmisc-22.13 squashfs-4.2 sysvinit-2.88 tar-1.17

u-boot-Aug-09 util-linux-ng-2.18 zlib-1.2.3

GNU LESSER GENERAL PUBLIC LICENSE

Version 2.1, February 1999

Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed.

[This is the first released version of the Lesser GPL. It also counts as the successor of the GNU Library Public

License, version 2, hence the version number 2.1.]

Preamble

The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU

General Public Licenses are intended to guarantee your freedom to share and change free software--to make sure the

software is free for all its users. This license, the Lesser General Public License, applies to some specially designated

software packages--typically libraries--of the Free Software Foundation and other authors who decide to use it. You

can use it too, but we suggest you first think carefully about whether this license or the ordinary General Public

License is the better strategy to use in any particular case, based on the explanations below. When we speak of free

software, we are referring to freedom of use, not price. Our General Public Licenses are designed to make sure that

you have the freedom to distribute copies of free software (and charge for this service if you wish); that you receive

source code or can get it if you want it; that you can change the software and use pieces of it in new free programs;

and that you are informed that you can do these things. To protect your rights, we need to make restrictions that forbid

distributors to deny you these rights or to ask you to surrender these rights.

These restrictions translate to certain responsibilities for you if you distribute copies of the library or if you modify it. For

example, if you distribute copies of the library, whether gratis or for a fee, you must give the recipients all the rights that

we gave you. You must make sure that they, too, receive or can get the source code. If you link other code with the

library, you must provide complete object files to the recipients, so that they can relink them with the library after

making changes to the library and recompiling it. And you must show them these terms so they know their rights. We

protect your rights with a two-step method: (1) we copyright the library, and (2) we offer you this license, which gives

you legal permission to copy, distribute and/or modify the library.

To protect each distributor, we want to make it very clear that there is no warranty for the free library. Also, if the library

is modified by someone else and passed on, the recipients should know that what they have is not the original version,

so that the original author's reputation will not be affected by problems that might be introduced by others. Finally,

software patents pose a constant threat to the existence of any free program. We wish to make sure that a company

cannot effectively restrict the users of a free program by obtaining a restrictive license from a patent holder. Therefore,

we insist that any patent license obtained for a version of the library must be consistent with the full freedom of use

specified in this license. Most GNU software, including some libraries, is covered by the ordinary GNU General Public

License. This license, the GNU Lesser General Public License, applies to certain designated libraries, and is quite

different from the ordinary General Public License. We use this license for certain libraries in order to permit linking

those libraries into non-free programs.

When a program is linked with a library, whether statically or using a shared library, the combination of the two is

legally speaking a combined work, a derivative of the original library. The ordinary General Public License therefore

permits such linking only if the entire combination fits its criteria of freedom. The Lesser General Public License

permits more lax criteria for linking other code with the library. We call this license the "Lesser" General Public License

because it does Less to protect the user's freedom than the ordinary General Public License. It also provides other

free software developers Less of an advantage over competing non-free programs. These disadvantages are the

reason we use the ordinary General Public License for many libraries. However, the Lesser license provides

advantages in certain special circumstances. For example, on rare occasions, there may be a special need to

encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, non-

free programs must be allowed to use the library.

A more frequent case is that a free library does the same job as widely used non-free libraries. In this case, there is

little to gain by limiting the free library to free software only, so we use the Lesser General Public License. In other

cases, permission to use a particular library in non-free programs enables a greater number of people to use a large

body of free software. For example, permission to use the GNU C Library in non-free programs enables many more

people to use the whole GNU operating system, as well as its variant, the GNU/Linux operating system. Although the

Lesser General Public License is Less protective of the users' freedom, it does ensure that the user of a program that

is linked with the Library has the freedom and the wherewithal to run that program using a modified version of the

Library. The precise terms and conditions for copying, distribution and modification follow. Pay close attention to the

difference between a "work based on the library" and a "work that uses the library". The former contains code derived

from the library, whereas the latter must be combined with the library in order to run.

TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION

0. This License Agreement applies to any software library or other program which contains a notice placed by the

License (also called "this License"). Each licensee is addressed as "you".

A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with

application programs (which use some of those functions and data) to form executables. The "Library", below,

refers to any such software library or work which has been distributed under these terms. A "work based on the

Library" means either the Library or any derivative work under copyright law: that is to say, a work containing the

Library or a portion of it, either verbatim or with modifications and/or translated straightforwardly into another

language. (Hereinafter, translation is included without limitation in the term "modification".) "Source code" for a work

means the preferred form of the work for making modifications to it. For a library, complete source code means all

the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to

control compilation and installation of the library.

Activities other than copying, distribution and modification are not covered by this License; they are outside its

scope. The act of running a program using the Library is not restricted, and output from such a program is covered

only if its contents constitute a work based on the Library (independent of the use of the Library in a tool for writing

it). Whether that is true depends on what the Library does and what the program that uses the Library does.

1. You may copy and distribute verbatim copies of the Library's complete source code as you receive it, in any

medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice

and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty;

and distribute a copy of this License along with the Library.

You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty

protection in exchange for a fee.

2. You may modify your copy or copies of the Library or any portion of it, thus forming a work based on the Library, and

copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all

of these conditions:

a) The modified work must itself be a software library.

b) You must cause the files modified to carry prominent notices stating that you changed the files and the date of

any change.

c) You must cause the whole of the work to be licensed at no charge to all third parties under the terms of this

License

If a facility in the modified Library refers to a function or a table of data to be supplied by an application program that

uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith

effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and

performs whatever part of its purpose remains meaningful.

(For example, a function in a library to compute square roots has a purpose that is entirely well-defined

independent of the application. Therefore, Subsection 2d requires that any application-supplied function or table

used by this function must be optional: if the application does not supply it, the square root function must still

compute square roots.) These requirements apply to the modified work as a whole. If identifiable sections of that

work are not derived from the Library, and can be reasonably considered independent and separate works in

themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate

works. But when you distribute the same sections as part of a whole which is a work based on the Library, the

distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the

entire whole, and thus to each and every part regardless of who wrote it.

Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather,

the intent is to exercise the right to control the distribution of derivative or collective works based on the Library. In

addition, mere aggregation of another work not based on the Library with the Library (or with a work based on the

Library) on a volume of a storage or distribution medium does not bring the other work under the scope of this

License.

3. You may opt to apply the terms of the ordinary GNU General Public License instead of this License to a given copy

of the Library. To do this, you must alter all the notices that refer to this License, so that they refer to the ordinary

GNU General Public License, version 2, instead of to this License. (If a newer version than version 2 of the ordinary

GNU General Public License has appeared, then you can specify that version instead if you wish.) Do not make

any other change in these notices.

Once this change is made in a given copy, it is irreversible for that copy, so the ordinary GNU General Public

License applies to all subsequent copies and derivative works made from that copy. This option is useful when you

wish to copy part of the code of the Library into a program that is not a library.

4. You may copy and distribute the Library (or a portion or derivative of it, under Section 2) in object code or

executable form under the terms of Sections 1 and 2 above provided that you accompany it with the complete

corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2

above on a medium customarily used for software interchange. If distribution of object code is made by offering

access to copy from a designated place, then offering equivalent access to copy the source code from the same

place satisfies the requirement to distribute the source code, even though third parties are not compelled to copy

the source along with the object code.

5. A program that contains no derivative of any portion of the Library, but is designed to work with the Library by being

compiled or linked with it, is called a "work that uses the Library". Such a work, in isolation, is not a derivative work

of the Library, and therefore falls outside the scope of this License.

However, linking a "work that uses the Library" with the Library creates an executable that is a derivative of the

Library (because it contains portions of the Library), rather than a "work that uses the library". The executable is

therefore covered by this License. Section 6 states terms for distribution of such executables. When a "work that

uses the Library" uses material from a header file that is part of the Library, the object code for the work may be a

derivative work of the Library even though the source code is not. Whether this is true is especially significant if the

work can be linked without the Library, or if the work is itself a library. The threshold for this to be true is not

precisely defined by law. If such an object file uses only numerical parameters, data structure layouts and

accessors, and small macros and small inline functions (ten lines or less in length), then the use of the object file is

unrestricted, regardless of whether it is legally a derivative work. (Executables containing this object code plus

portions of the Library will still fall under Section 6.) Otherwise, if the work is a derivative of the Library, you may

distribute the object code for the work under the terms of Section 6. Any executables containing that work also fall

under Section 6, whether or not they are linked directly with the Library itself.

6. As an exception to the Sections above, you may also combine or link a "work that uses the Library" with the Library

to produce a work containing portions of the Library, and distribute that work under terms of your choice, provided

that the terms permit modification of the work for the customer's own use and reverse engineering for debugging

such modifications.

You must give prominent notice with each copy of the work that the Library is used in it and that the Library and its

use are covered by this License. You must supply a copy of this License. If the work during execution displays

directing the user to the copy of this License. Also, you must do one of these things:

Accompany the work with the complete corresponding machine-readable source code for the Library including

whatever changes were used in the work (which must be distributed under Sections 1 and 2 above); and, if the

work is an executable linked with the Library, with the complete machine-readable "work that uses the Library", as

object code and/or source code, so that the user can modify the Library and then relink to produce a modified

executable containing the modified Library. (It is understood that the user who changes the contents of definitions

files in the Library will not necessarily be able to recompile the application to use the modified definitions.)

b) Use a suitable shared library mechanism for linking with the Library. A suitable mechanism is one that (1) uses at

run time a copy of the library already present on the user's computer system, rather than copying library

functions into the executable, and (2) will operate properly with a modified version of the library, if the user

installs one, as long as the modified version is interface-compatible with the version that the work was made

with.

c) Accompany the work with a written offer, valid for at least three years, to give the same user the materials

specified in Subsection 6a, above, for a charge no more than the cost of performing this distribution.

d) If distribution of the work is made by offering access to copy from a designated place, offer equivalent access to

copy the above specified materials from the same place.

e) Verify that the user has already received a copy of these materials or that you have already sent this user a copy.

For an executable, the required form of the "work that uses the Library" must include any data and utility programs

needed for reproducing the executable from it. However, as a special exception, the materials to be distributed

need not include anything that is normally distributed (in either source or binary form) with the major components

(compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself

accompanies the executable. It may happen that this requirement contradicts the license restrictions of other

proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot

use both them and the Library together in an executable that you distribute.

7. You may place library facilities that are a work based on the Library side-by-side in a single library together with

other library facilities not covered by this License, and distribute such a combined library, provided that the

separate distribution of the work based on the Library and of the other library facilities is otherwise permitted, and

provided that you do these two things:

a) Accompany the combined library with a copy of the same work based on the Library, uncombined with any other

library facilities. This must be distributed under the terms of the Sections above.

b) Give prominent notice with the combined library of the fact that part of it is a work based on the Library, and

explaining where to find the accompanying uncombined form of the same work.

8. You may not copy, modify, sublicense, link with, or distribute the Library except as expressly provided under this

License. Any attempt otherwise to copy, modify, sublicense, link with, or distribute the Library is void, and will

automatically terminate your rights under this License. However, parties who have received copies, or rights, from

you under this License will not have their licenses terminated so long as such parties remain in full compliance.

9. You are not required to accept this License, since you have not signed it. However, nothing else grants you

permission to modify or distribute the Library or its derivative works. These actions are prohibited by law if you do

not accept this License. Therefore, by modifying or distributing the Library (or any work based on the Library), you

indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or

modifying the Library or works based on it.

10.

Each time you redistribute the Library (or any work based on the Library), the recipient automatically receives a

license from the original licensor to copy, distribute, link with or modify the Library subject to these terms and

conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You

are not responsible for enforcing compliance by third parties with this License.

11.

If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to

patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the

conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as

to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a

consequence you may not distribute the Library at all. For example, if a patent license would not permit royalty-free

redistribution of the Library by all those who receive copies directly or indirectly through you, then the only way you

could satisfy both it and this License would be to refrain entirely from distribution of the Library.

If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the

section is intended to apply, and the section as a whole is intended to apply in other circumstances. It is not the

purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of

any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system

which is implemented by public license practices. Many people have made generous contributions to the wide

range of software distributed through that system in reliance on consistent application of that system; it is up to the

author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot

impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the

rest of this License.

12.

If the distribution and/or use of the Library is restricted in certain countries either by patents or by copyrighted

interfaces, the original copyright holder who places the Library under this License may add an explicit geographical

distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus

excluded. In such case, this License incorporates the limitation as if written in the body of this License.

13.

The Free Software Foundation may publish revised and/or new versions of the Lesser General Public License from

time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new

problems or concerns.

Each version is given a distinguishing version number. If the Library specifies a version number of this License

which applies to it and "any later version", you have the option of following the terms and conditions either of that

version or of any later version published by the Free Software Foundation. If the Library does not specify a license

version number, you may choose any version ever published by the Free Software Foundation.

14.

If you wish to incorporate parts of the Library into other free programs whose distribution conditions are

incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free

Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision

will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting

the sharing and reuse of software generally.

＊ NO WARRANTY

15.

BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE LIBRARY,

TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE

OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED

WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS

TO THE QUALITY AND PERFORMANCE OF THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE

DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION.

16.

IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT

HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED

ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR

CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE LIBRARY (INCLUDING

BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY

YOU OR THIRD PARTIES OR A FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE),

EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES.

END OF TERMS AND CONDITIONS

How to Apply These Terms to Your New Libraries

If you develop a new library, and you want it to be of the greatest possible use to the public, we recommend making it

free software that everyone can redistribute and change. You can do so by permitting redistribution under these terms

(or, alternatively, under the terms of the ordinary General Public License). To apply these terms, attach the following

notices to the library. It is safest to attach them to the start of each source file to most effectively convey the exclusion

of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found.

This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General

Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option)

any later version. This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without

even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU

Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public

License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330,

Boston, MA 02111-1307 USA

Also add information on how to contact you by electronic and paper mail. You should also get your employer (if you

work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if necessary. Here is a

sample; alter the names:

Yoyodyne, Inc., hereby disclaims all copyright interest in the library `Frob' (a library for tweaking knobs) written by

James Random Hacker.

signature of Ty Coon, 1 April 1990

Ty Coon, President of Vice

That's all there is to it!

GNU GENERAL PUBLIC LICENSE

Version 2, June 1991

Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed.

Preamble

The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU

General Public License is intended to guarantee your freedom to share and change free software--to make sure the

software is free for all its users. This General Public License applies to most of the Free Software Foundation's

software and to any other program whose authors commit to using it. (Some other Free Software Foundation software

is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we

speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure

that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you

receive source code or can get it if you want it, that you can change the software or use pieces of it in new free

programs; and that you know you can do these things.

To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to

surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the

software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you

must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source

code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1)

copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify

the software. Also, for each author's protection and ours, we want to make certain that everyone understands that

there is no warranty for this free software. If the software is modified by someone else and passed on, we want its

recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on

the original authors' reputations.

Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors

of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we

have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms

and conditions for copying, distribution and modification follow.

TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION

0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it

may be distributed under the terms of this General Public License. The "Program", below, refers to any such

program or work, and a "work based on the Program" means either the Program or any derivative work under

and/or translated into another language. (Hereinafter, translation is included without limitation in the term

"modification".) Each licensee is addressed as "you".

Activities other than copying, distribution and modification are not covered by this License; they are outside its

scope. The act of running the Program is not restricted, and the output from the Program is covered only if its

contents constitute a work based on the Program (independent of having been made by running the Program).

Whether that is true depends on what the Program does.

1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium,

provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and

disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and

give any other recipients of the Program a copy of this License along with the Program.

You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty

protection in exchange for a fee.

2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program,

and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also

meet all of these conditions:

a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of

any change.

b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the

Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this

License.

c) If the modified program normally reads commands interactively when run, you must cause it, when started

running for such interactive use in the most ordinary way, to print or display an announcement including an

appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty)

and that users may redistribute the program under these conditions, and telling the user how to view a copy of

this License. (Exception: if the Program itself is interactive but does not normally print such an announcement,

your work based on the Program is not required to print an announcement.)

These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from

the Program, and can be reasonably considered independent and separate works in themselves, then this License,

and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute

the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be

on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each

and every part regardless of who wrote it.

Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather,

the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In

addition, mere aggregation of another work not based on the Program with the Program (or with a work based on

the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this

License.

3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form

under the terms of Sections 1 and 2 above provided that you also do one of the following:

a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under

the terms of Sections 1 and 2 above on a medium customarily used for software interchange;or,

b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than

your cost of physically performing source distribution, a complete machine-readable copy of the corresponding

source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for

software interchange; or,

c) Accompany it with the information you received as to the offer to distribute corresponding source code.

(This alternative is allowed only for noncommercial distribution and only if you received the program in object

code or executable form with such an offer, in accord with Subsection b above.)

The source code for a work means the preferred form of the work for making modifications to it. For an executable

work, complete source code means all the source code for all mo

dules it contains, plus any associated interface

definition files, plus the scripts used to control compilation and installation of the executable. However, as a special

exception, the source code distributed need not include anything that is normally distributed (in either source or

binary form) with the major components (compiler, kernel, and so on) of the operating system on which the

executable runs, unless that component itself accompanies the executable. If distribution of executable or object

code is made by offering access to copy from a designated place, then offering equivalent access to copy the

source code from the same place counts as distribution of the source code, even though third parties are not

compelled to copy the source along with the object code.

You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any

attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your

rights under this License. However, parties who have received copies, or rights, from you under this License will not have

their licenses terminated so long as such parties remain in full compliance.

5. You are not required to accept this License, since you have not signed it. However, nothing else grants you

permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do

not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program),

you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or

modifying the Program or works based on it.

Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a

license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You

may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible

for enforcing compliance by third parties to this License.

7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to

patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the

conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as

to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a

consequence you may not distribute the Program at all. For example, if a patent license would not permit royalty-

free redistribution of the Program by all those who receive copies directly or indirectly through you, then the only

way you could satisfy both it and this License would be to refrain entirely from distribution of the Program.

If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the

section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the

purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of

any such claims; this section has the sole purpose of protecting the integrity of the free software distribution

system, which is implemented by public license practices. Many people have made generous contributions to the

wide range of software distributed through that system in reliance on consistent application of that system; it is up

to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee

cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence

of the rest of this License.

8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted

interfaces, the original copyright holder who places the Program under this License may add an explicit

geographical distribution limitation excluding those countries, so that distribution is permitted only in or among

countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this

License.

9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to

time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new

problems or concerns.

Each version is given a distinguishing version number. If the Program specifies a version number of this License

which applies to it and "any later version", you have the option of following the terms and conditions either of that

version or of any later version published by the Free Software Foundation. If the Program does not specify a

version number of this License, you may choose any version ever published by the Free Software Foundation.

10.

If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different,

write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write

to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two

goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of

software generally.

NO WARRANTY

11.

BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE

PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN

WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS"

WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED

TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE

ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE

PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR

CORRECTION.

12.

IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT

HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED

ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR

CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING

BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY

YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS),

EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES.

END OF TERMS AND CONDITIONS

How to Apply These Terms to Your New Programs

If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve

this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the

following notices to the program. It is safest to attach them to the start of each source file to most effectively convey

the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is

found.

This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public

License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later

version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even

the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General

Public License for more details. You should have received a copy of the GNU General Public License along with this

program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307,

USA.

Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a

short notice like this when it starts in an interactive mode:

Gnomovision version 69, Copyright (C) year name of author Gnomovision comes with ABSOLUTELY NO

WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain

conditions; type `show c' for details.

The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License.

Of course, the commands you use may be called something other than `show w' and `show c'; they could even be

mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a

programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample;

alter the names:

Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at

compilers) written by James Hacker.

<signature of Ty Coon>, 1 April 1989

Ty Coon, President of Vice

This General Public License does not permit incorporating your program into proprietary programs. If your program is

a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is

what you want to do, use the GNU Library General Public License instead of this License.

Notice Regarding Third-party Software / その他第三者ソフトウェアに関するお知らせ

This product includes the following software that is directly or indirectly licensed to O&P Corporation by third-party

developers. Please refer to the PDF files on the following website about the notice in response to requests from the

https://www.onkyo.com/manual/oss/2017pd.pdf

本製品には弊社が第三者より直接的に又は間接的に使用の許諾を受けた下記ソフトウェアが含まれておりま

す。各ソフトウェアの著作権者の要求に基づく通知については、以下のサイトより PDF ファイルをご参照く

ださい。

https://www.onkyo.com/manual/oss/2017pd.pdf

You may obtain a complete machine-readable copy of the corresponding source code on a physical medium by

contacting Customer Service.

This offer is valid to any third party within three years after last shipment of the product. Costs of physical distribution

will be charged.

コールセンターにお問い合わせいただければ、対応するソースコードの完全な機械可読コピーを物理メディア

でお渡しします。

製品の最終出荷後、3 年間有効です。掛かる費用についてはご負担いただきます。

1-10-5 Yokoami, Sumida-ku, Tokyo 130-0015 JAPAN

<U.S.A.>

18 PARK WAY, UPPER SADDLE RIVER, NEW JERSEY 07458, U.S.A.

Tel: 1-201-785-2600 Tel: 1-844-679-5350

Gutenbergstrasse 3, 82178 Puchheim, Germany

Tel: +49 (0)89 2170 497 97 (For Product Support only)

https://www.pioneer-audiovisual.eu/de

<UK>

Meridien House, Ground Floor, 69-71 Clarendon Road,

Watford, Hertfordshire WD17 1DS, United Kingdom

Tel: +44 (0)20 3936 8086 (For Product Support only)

https://www.pioneer-audiovisual.eu/uk

6, Avenue de Marais F - 95816 Argenteuil Cedex France

Tel: +33 (0)1 82 88 15 06 (For Product Support only)

https://www.pioneer-audiovisual.eu/fr

EU Official Web Site

https://www.pioneer-audiovisual.eu/eu

Registre su producto en

http://www.pioneerelectronics.com (US)

http://www.pioneerelectronics.ca (Canada)

H1909-0

SN 29403686

Printed in Malaysia / Imprimé en Malaisie

*29403686*

“Pioneer” is a trademark of Pioneer Corporation, and is used under license.

Documenttranscriptie

> Before Start > Part Names > Install > Playback Advanced Setup | Others SUPER AUDIO CD PLAYER PD-50AE Instruction Manual En Fr Es It De Nl Sv Before Start Safety Information .................................................................. 2 What's in the box .................................................................... 3 Part Names Front Panel ............................................................................. 4 Rear Panel .............................................................................. 5 Remote Controller .................................................................. 6 Display .................................................................................... 7 Install Connections with an amplifier ................................................. 8 Connecting the power cord, etc. ............................................11 Playback Playing discs ......................................................................... 12 Using this unit as a D/A converter ........................................ 14 Adjusting sound quality ......................................................... 15 Advanced Setup Advanced Settings................................................................. 16 Others Troubleshooting .................................................................... 17 Other notes............................................................................ 18 General Specifications........................................................... 19 > Before Start > Part Names > Install > Playback Advanced Setup | Others Safety Information Before Start WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR 7KH OLJKWQLQJ IODVK ZLWK DUURZKHDG V\PERO ZLWKLQ DQ HTXLODWHUDO WULDQJOH LV LQWHQGHG WR DOHUW WKH XVHU WR WKH SUHVHQFH RI XQLQVXODWHG ³GDQJHURXV YROWDJH´ ZLWKLQ WKH SURGXFW¶VHQFORVXUHWKDWPD\EHRIVXႈFLHQWPDJQLWXGHWR FRQVWLWXWHDULVNRIHOHFWULFVKRFNWRSHUVRQV 7KH H[FODPDWLRQ SRLQW ZLWKLQ DQ HTXLODWHUDO WULDQJOH LV LQWHQGHG WR DOHUW WKH XVHU WR WKH SUHVHQFH RI LPSRUWDQW RSHUDWLQJ DQG PDLQWHQDQFH VHUYLFLQJ LQVWUXFWLRQV LQ WKH OLWHUDWXUHDFFRPSDQ\LQJWKHDSSOLDQFH &$87,21 7235(9(177+(5,6.2)(/(&75,&6+2&.'21275(029( &29(5 25 %$&. 12 86(56(59,&($%/( 3$576 ,16,'( 5()(56(59,&,1*7248$/,),('6(59,&(3(56211(/ :$51,1* 7235(9(177+(5,6.2)(/(&75,&6+2&.'21275(029( &29(5 25 %$&. 12 86(56(59,&($%/( 3$576 ,16,'( 5()(56(59,&,1*7248$/,),('6(59,&(3(56211(/ 7KLVHTXLSPHQWLVQRWZDWHUSURRI7RSUHYHQWD¿UHRUVKRFNKD]DUGGR QRWSODFHDQ\FRQWDLQHU¿OOHGZLWKOLTXLGQHDUWKLVHTXLSPHQW VXFKDVD YDVHRUÀRZHUSRW RUH[SRVHLWWRGULSSLQJVSODVKLQJUDLQRUPRLVWXUH 7RSUHYHQWD¿UHKD]DUGGRQRWSODFHDQ\QDNHGÀDPHVRXUFHV VXFK DVDOLJKWHGFDQGOH RQWKHHTXLSPHQW 'RQRWXVHRUVWRUHEDWWHULHVLQGLUHFWVXQOLJKWRURWKHUH[FHVVLYHO\KRW SODFHVXFKDVLQVLGHDFDURUQHDUDKHDWHU7KLVFDQFDXVHEDWWHULHV WR OHDN RYHUKHDW H[SORGH RU FDWFK ¿UH ,W FDQ DOVR UHGXFH WKH OLIH RU SHUIRUPDQFHRIEDWWHULHV 6WRUHVPDOOSDUWVRXWRIWKHUHDFKRIFKLOGUHQDQGLQIDQWV,IDFFLGHQWDOO\ VZDOORZHGFRQWDFWDGRFWRULPPHGLDWHO\ 6ORWVDQGRSHQLQJVLQWKHFDELQHWDUHSURYLGHGIRUYHQWLODWLRQWRHQVXUH UHOLDEOHRSHUDWLRQRIWKHSURGXFWDQGWRSURWHFWLWIURPRYHUKHDWLQJ7R SUHYHQW¿UHKD]DUGWKHRSHQLQJVVKRXOGQHYHUEHEORFNHGRUFRYHUHG ZLWKLWHPV VXFKDVQHZVSDSHUVWDEOHFORWKVFXUWDLQV RUE\RSHUDWLQJ WKHHTXLSPHQWRQWKLFNFDUSHWRUDEHG 5LVN RI H[SORVLRQ LI EDWWHU\ LV UHSODFHG E\ DQ LQFRUUHFW W\SH 5LVN RI H[SORVLRQ,IGLVSRVDORIDEDWWHU\LQWR¿UHRUDKRWRYHQRUPHFKDQLFDOO\ FUXVKLQJRUFXWWLQJRIDEDWWHU\ 2 3UHFDXWLRQV ,I\RXLQVWDOOWKHDSSDUDWXVLQDEXLOWLQLQVWDOODWLRQVXFKDVDERRNFDVH RUUDFNHQVXUHWKDWWKHUHLVDGHTXDWHYHQWLODWLRQ /HDYHFP ´ RIIUHHVSDFHDWWKHWRSDQGVLGHVDQGFP ´ DW WKHUHDU7KHUHDUHGJHRIWKHVKHOIRUERDUGDERYHWKHDSSDUDWXVVKDOO EHVHWFP ´ DZD\IURPWKHUHDUSDQHORUZDOOFUHDWLQJDÀXHOLNH JDSIRUZDUPDLUWRHVFDSH 2SHUDWLQJ(QYLURQPHQW 2SHUDWLQJHQYLURQPHQWWHPSHUDWXUHDQGKXPLGLW\&WR& )WR) OHVVWKDQ5+ FRROLQJYHQWVQRWEORFNHG 'RQRWLQVWDOOWKLVXQLWLQDSRRUO\YHQWLODWHGDUHDRULQORFDWLRQVH[SRVHG WRKLJKKXPLGLW\RUGLUHFWVXQOLJKW RUVWURQJDUWL¿FLDOOLJKW ,PSRUWDQW1RWLFH 7KHPRGHOQXPEHUDQGVHULDOQXPEHURIWKLVHTXLSPHQWDUHRQWKHUHDU RUERWWRP5HFRUGWKHVHQXPEHUVRQ\RXUHQFORVHGZDUUDQW\FDUGDQG NHHSLQDVDIHSODFHIRUIXWXUHUHIHUHQFH &$87,21 7KH SRZHU VZLWFK EXWWRQ RQ WKLV XQLW ZLOO QRW FRPSOHWHO\ VKXW RII DOO SRZHU IURP WKH$& RXWOHW 6LQFH WKH SRZHU FRUG VHUYHV DV WKH PDLQ GLVFRQQHFW GHYLFH IRU WKH XQLW \RX ZLOO QHHG WR XQSOXJ LW IURP WKH$& RXWOHWWRVKXWGRZQDOOSRZHU7KHUHIRUHPDNHVXUHWKHXQLWKDVEHHQ LQVWDOOHG VR WKDW WKH SRZHU FRUG FDQ EH HDVLO\ XQSOXJJHG IURP WKH $&RXWOHWLQFDVHRIDQDFFLGHQW7RDYRLG¿UHKD]DUGWKHSRZHUFRUG VKRXOG DOVR EH XQSOXJJHG IURP WKH$& RXWOHW ZKHQ OHIW XQXVHG IRU D ORQJSHULRGRIWLPH IRUH[DPSOHZKHQRQYDFDWLRQ 7KLVSURGXFWLVIRUJHQHUDOKRXVHKROGSXUSRVHV$Q\IDLOXUHGXHWRXVH IRURWKHUWKDQKRXVHKROGSXUSRVHV VXFKDVORQJWHUPXVHIRUEXVLQHVV SXUSRVHV LQ D UHVWDXUDQW RU XVH LQ D FDU RU VKLS DQG ZKLFK UHTXLUHV UHSDLUZLOOEHFKDUJHGIRUHYHQGXULQJWKHZDUUDQW\SHULRG 3RZHU&RUG&DXWLRQ +DQGOHWKHSRZHUFRUGE\WKHSOXJ'RQRWSXOORXWWKHSOXJE\WXJJLQJ WKH FRUG DQG QHYHU WRXFK WKH SRZHU FRUG ZKHQ \RXU KDQGV DUH ZHW DV WKLV FRXOG FDXVH D VKRUW FLUFXLW RU HOHFWULF VKRFN 'R QRW SODFH WKH XQLW D SLHFH RI IXUQLWXUH HWF RQ WKH SRZHU FRUG RU SLQFK WKH FRUG 1HYHU PDNH D NQRW LQ WKH FRUG RU WLH LW ZLWK RWKHU FRUGV7KH SRZHU FRUGVVKRXOGEHURXWHGVXFKWKDWWKH\DUHQRWOLNHO\WREHVWHSSHGRQ$ GDPDJHGSRZHUFRUGFDQFDXVHD¿UHRUJLYH\RXDQHOHFWULFDOVKRFN &KHFN WKH SRZHU FRUG RQFH LQ D ZKLOH :KHQ \RX ILQG LW GDPDJHG DVN \RXU QHDUHVW RXU DXWKRUL]HG VHUYLFH FHQWHU RU \RXU GHDOHU IRU D UHSODFHPHQW &$87,21 7KLV SURGXFW LV D FODVV ODVHU SURGXFW FODVVL¿HG XQGHU WKH 6DIHW\ RI ODVHUSURGXFWV,(& CLASS 1 LASER PRODUCT ,QIRUPDWLRQIRUXVHUVRQFROOHFWLRQDQGGLVSRVDO RIROGHTXLSPHQWDQGXVHGEDWWHULHV Symbol for equipment Symbol examples for batteries Pb 7KHVHV\PEROVRQWKHSURGXFWVSDFNDJLQJDQGRUDFFRPSDQ\LQJ GRFXPHQWVPHDQWKDWXVHGHOHFWULFDODQGHOHFWURQLFSURGXFWVDQG EDWWHULHVVKRXOGQRWEHPL[HGZLWKJHQHUDOKRXVHKROGZDVWH )RUSURSHUWUHDWPHQWUHFRYHU\DQGUHF\FOLQJRIROGSURGXFWVDQG XVHGEDWWHULHVSOHDVHWDNHWKHPWRDSSOLFDEOHFROOHFWLRQSRLQWVLQ DFFRUGDQFHZLWK\RXUQDWLRQDOOHJLVODWLRQ %\GLVSRVLQJRIWKHVHSURGXFWVDQGEDWWHULHVFRUUHFWO\\RXZLOOKHOS WRVDYHYDOXDEOHUHVRXUFHVDQGSUHYHQWDQ\SRWHQWLDOQHJDWLYH HႇHFWVRQKXPDQKHDOWKDQGWKHHQYLURQPHQWZKLFKFRXOG RWKHUZLVHDULVHIURPLQDSSURSULDWHZDVWHKDQGOLQJ )RUPRUHLQIRUPDWLRQDERXWFROOHFWLRQDQGUHF\FOLQJRIROGSURGXFWV DQGEDWWHULHVSOHDVHFRQWDFW\RXUORFDOPXQLFLSDOLW\\RXUZDVWH GLVSRVDOVHUYLFHRUWKHSRLQWRIVDOHZKHUH\RXSXUFKDVHGWKH LWHPV 7KHVHV\PEROVDUHRQO\YDOLGLQWKH(XURSHDQ8QLRQ )RUFRXQWULHVRXWVLGHWKH(XURSHDQ8QLRQ ,I\RXZLVKWRGLVFDUGWKHVHLWHPVSOHDVHFRQWDFW\RXUORFDO DXWKRULWLHVRUGHDOHUDQGDVNIRUWKHFRUUHFWPHWKRGRIGLVSRVDO :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Before Start > Part Names > Install > Playback Advanced Setup | Others What's in the box 1. 2. 3. 4. • 1 2 3 Main unit (1) Remote controller (RC-980C) (1), Batteries (AAA/R03) (2) Analog Audio Cable (For testing operation) (1) Power Cord (1) Instruction Manual (This document) (1) • The power cord must be connected only after all other cable connections are completed. • We will not accept responsibility for damage arising from the connection of equipment manufactured by other companies. • Specifications and appearance are subject to change without prior notice. The main power cannot be turned on or off with the remote controller. Use the 8 STANDBY/ ON button on the main unit. 4 En 3 > Before Start > Part Names > Install > Playback Advanced Setup | Others Front Panel Part Names 1 6 2 3 7 8 9 1. 8 STANDBY/ON button/indicator: Switch the main power of the unit on and off. When starting up the unit, the indicator in the center of the button lights blue. 2. STANDBY indicator: Lights red when the unit is in standby mode. 3. Disc tray: Place discs here. 8-cm discs can also be used. 4. ; button: Open or close the disc tray. 5. Play buttons: u t : Return to the beginning of the track being played. Press again to move to the track before. Press and hold to rewind the track quickly. q/h : Play or pause play. y i : When pressed during play, move to the next track. Press and hold to fastforward through the track. g : This button stops playback. 6. Remote control sensor • The reception range of the remote controller is within a distance of approx. 16´/5 m, and an angle of 20° in vertical direction and 30° to right and left. 4 4 5 bk bl 7. CD/SACD button/indicator: Switch between CD/SACD as the source. When playing a hybrid SACD, the layer being played switches if you press this during play. (P18) The indicator lights blue when SACD is selected. 8. DIRECT button/indicator: Switch the DIRECT mode ON and OFF. (P15) The indicator lights blue when the DIRECT mode is ON. 9. Display (P7) 10.SOURCE button: Switches the source to be played. 11. SETUP button: Displays the SETUP menu. (P16) > Before Start > Part Names > Install > Playback Advanced Setup | Others Rear Panel 1 2 3 4 5 1. ANALOG OUT jack: Use an analog audio cable to connect an integrated amplifier, for example. 2. AC IN: Connect the supplied power cord. 3. USB DAC port: Use a USB cable (A-B type) to connect a computer. 4. DIGITAL OUT OPTICAL/COAXIAL jack: Use a digital optical cable or digital coaxial cable to connect an integrated amplifier, for example. 5. CONTROL IN/OUT jack: By connecting Pioneer brand amplifiers and audio devices, centralized control is possible, for example you can control the amplifiers and audio devices. En 5 > Before Start > Part Names > Install > Playback Advanced Setup | Others Remote Controller 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. ^ STANDBY/ON button: When the main power of the unit is on, this turns the unit on or into standby mode. The main power cannot be turned on or off with the remote controller. 2. SHUFFLE button: Set shuffle play. (P13) 3. REPEAT button: Set repeat play. (P13) 4. Numbered buttons: Use to directly input the track number of a music CD when selecting tracks. Also used to enter track numbers for program play. 5. CLEAR button: Clear the content set for program play. (P13) 6. DIGITAL FILTER button: Select one of three types of DIGITAL FILTER. (P15) 7. Cursors, ENTER button: Select the item with the cursors and press ENTER to confirm. 8. SETUP button: Displays the SETUP menu. (P16) 9. Play buttons: u : Return to the beginning of the track being played. Press again to move to the track before. /h : Play or pause play. i : Move to the next track. t : Press and hold to fast-rewind through the track being played. g : Stop playback. y : Press and hold to fast-forward through the track being played. 10.SOURCE button: Switches the source to be played. 11. DIRECT button: Switch the DIRECT mode on and off. (P15) 12.DISPLAY button: Switch the information on the display. • Depending on the source, the operation may not start. 13.; OPEN/CLOSE button: Open or close the disc tray. 14.PROGRAM button: Used for program play. (P13) 15.LOCK RANGE button: Displays the LOCK RANGE ADJUST settings screen. (P15) 16.RETURN button: Returns the display to the previous state. 17.UP SAMPLING button: Switch the UP SAMPLING feature ON and OFF. (P15) 18.CD/SACD button: Switch between CD/SACD as the source. When playing a hybrid SACD, the layer being played switches if you press this during play. (P18) 19.DIGITAL OUT button: Switch the digital output ON and OFF. (P16) 20.DISPLAY OFF button: Press to turn off the display of this unit. Press again to turn the display on. 21.DIMMER button: You can adjust the brightness of the display in three steps. (Default Value: Level 3) Match the polarity when inserting the batteries. > Before Start > Part Names > Install > Playback Advanced Setup | Others Display 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Lights during play of SACD and DSD. 2. Message display: Displays information about tracks and menus. 3. Lights when operations with the cursor buttons on the remote controller are possible. 4. Displays the play status. 5. Lights when the digital audio output setting is on. (P16) 6. Lights when showing such items as the remaining time for a track or the disc, or the total time of the disc. 7. Display when an MQA file or stream is played. For details, refer to "Playing MQA". (P18) En 7 > Before Start > Part Names > Install > Playback Advanced Setup | Others Connections with an amplifier Install This unit 1 a 2 1 a a 2 Integrated amplifier, AV receiver, etc. Play the audio from discs played on this unit and from devices connected to this unit through speaker systems connected to integrated amplifiers or AV receivers. Connect to suit the input jacks on your amplifier. 8 a Analog Audio Cable Connecting with an analog audio cable The signal is converted to analog in the D/A converter of this unit and then output to an integrated amplifier, for example. Connect the LINE IN jacks on an integrated amplifier to the ANALOG OUT jack (RCA jack) on this unit. > Before Start > Part Names > Install > Playback Advanced Setup | Others Connecting with a digital optical cable Connecting with a digital coaxial cable The signal is converted to analog in the D/A converter of the integrated amplifier, for example. Connect the OPTICAL IN jack on an integrated amplifier to the DIGITAL OUT OPTICAL jack on this unit. • The audio of SACD and DSD or input from USB DAC is not output from the DIGITAL OUT OPTICAL jack of this unit. The signal is converted to analog in the D/A converter of the integrated amplifier, for example. Connect the COAXIAL IN jack on an integrated amplifier to the DIGITAL OUT COAXIAL jack on this unit. • The audio of SACD and DSD or input from USB DAC is not output from the DIGITAL OUT COAXIAL jack of this unit. • The digital signals that can be output by this unit are linear PCM signals with a sampling frequency and quantization bit rate of 192 kHz/24 bit (operation may not be possible with all connected devices or environments). • The digital signals that can be output by this unit are linear PCM signals with a sampling frequency and quantization bit rate of 192 kHz/24 bit (operation may not be possible with all connected devices or environments). En 9 > Before Start > Part Names > Install > Playback Advanced Setup | Others The control jack If you have multiple Pioneer brand devices, and if they have CONTROL IN/OUT jacks, you can centrally control them through the remote controller sensor on the amplifier, for example. By connecting with monaural miniplug cables (without resistors) as shown in the diagram, then even if this unit and other devices are put in locations where they cannot receive the remote controller signal, you can still use the remote controller to control this unit or other devices by pointing the remote controller at the remote controller sensor on the amplifier, for example. • Also make sure to connect with the analog audio cable. Centralized control cannot work correctly with only the control jack connection. • The remote controller sensor on this unit stops working if you connect a monaural miniplug cable (without resistor) to the CONTROL IN jack of this unit. • The remote controller sensors on the other devices stop working if you connect a monaural miniplug cable (without resistor) to the CONTROL OUT jack of this unit. • If a Pioneer brand network player and amplifier is connected by the CONTROL IN/OUT jack, you can perform basic operations on this unit, the network player, and amplifier on a smart phone app over a network. (One example of connection) IN OUT CONTROL a Amplifier a This unit IN OUT CONTROL Audio device a Monaural Miniplug Cables (without resistors) 10 > Before Start > Part Names > Install > Playback Advanced Setup | Others Connecting the power cord, etc. 1 Power cord connection 2 a a a Power Cord This model includes a removable power cord. The power cord must be connected only after all other connections are completed. Make sure you first connect the power cord to AC IN terminal of the unit and then connect to the outlet. Always disconnect the outlet side first when disconnecting the power cord. Starting up Press 8 STANDBY/ON on the main unit. • When starting up, press until the button goes in. When starting up the unit, the 8 STANDBY/ON indicator in the center of the button lights blue. En 11 > Before Start > Part Names > Install > Playback Advanced Setup | Others Playing discs Playback 1 Refer to (P18) for discs you can play on this unit. • Characters that cannot be displayed by this unit appear as "". Playing music CDs Perform the following procedure when the unit is on. 1. Press CD/SACD on the remote controller to set the source to CD/SACD. 2. Press ; on the main unit to open the disc tray, and after putting the disc on the tray, press ; again to close the tray. 3. Press /h (g) on the remote controller to start play. 4. Use play buttons (h) to stop play or choose tracks to play. You can also select by entering the track number with number buttons (b). When entering a 2-digit track number, press the +10 button as many times as the value of the second (tens) digit, then press the value of the first digit. If you press DISPLAY (d), you can switch the display to show the elapsed time or remaining time of the disc, etc. • The content displayed depends on the disc. a e b c f Playing a disc with music files 2 12 Perform the following procedure when the unit is on. 1. Press CD/SACD on the remote controller to set the source to CD/SACD. 2. Press ; on the main unit to open the disc tray, and after putting the disc on the tray, press ; again to close the tray. 3. Press /h (g) on the remote controller to start play. 4. Use play buttons (h) to stop play or choose tracks to play. If you press DISPLAY (d), you can switch the display to show the elapsed time or remaining time of the disc, the file name of the track, or the track name, etc. • The content displayed depends on the disc and file. • Track name display is supported with MP3/WMA/ FLAC/AAC (M4A only)/DSD (DSF only) format music files only. g h d > Before Start > Part Names > Install > Playback Advanced Setup | Others Repeat play Specifications of files that can be played 1. Repeatedly press REPEAT (a) during play to display or 1 on the display. ALL : Repeat play of all tracks. 1 : Repeat play of the being played track. To cancel repeat play, press REPEAT (a) several times to display OFF on the display. ALL Sampling rates MP3 WMA Shuffle play 1. Press SHUFFLE (f) during play or stop to display on the display. : Play all tracks randomly. To cancel shuffle play, press SHUFFLE (f) to display OFF on the display. AAC WAV AIFF FLAC Program play You can select the order to play tracks on a music CD. 1. Press PROGRAM (e) while stopped. "P00" is displayed when nothing has been registered. Enter the track number you want to register with the number buttons (b). When entering a 2-digit track number, press the +10 button as many times as the value of the second (tens) digit, then press the value of the first digit. The number in "P00" increases each time you register a track. Up to 24 tracks can be registered. • To play the registered program, press /h (g) on the remote controller. • If you press CLEAR (c) while registering tracks, the tracks are cleared in order, starting from the one you registered last. • If you press PROGRAM (e) while registering tracks, all the tracks you registered are cleared. • If the total play time of the registered program exceeds 99 minutes 59 seconds, " : " is displayed on the display. ALAC DSD Bitrates Between 8 kbps and 320 kbps and VBR. Between 5 kbps and 44.1/48 kHz 192 kbps and VBR. Between 8 kbps and 44.1/48/88.2/96 kHz 320 kbps and VBR. 44.1/48/88.2/96/ – 176.4/192 kHz 44.1/48/88.2/96/ – 176.4/192 kHz 44.1/48/88.2/96/ – 176.4/192 kHz 44.1/48/88.2/96/ – 176.4/192 kHz 44.1/48 kHz 2.8/5.6 MHz – Quantization bit Types of discs that can be played CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW Extension – .mp3 – .wma – * .aac/ .m4a 8/16/24 bit * .wav 8/16/24 bit * .aif/ .aiff 8/16/24 bit * .flac 8/16/24 bit * .m4a 1 bit – .dsf/ .dff .flac/ .wav 44.1/48/88.2/96/176.4/ * – 8/16/24 bit 192/352.8/384 kHz * When playing files exceeding 48 kHz, use files that have been recorded on a DVD disc. Notes regarding all types of files • Use CD/CD-R/CD-RW discs that conform to the ISO9660 level 1/level 2 CD-ROM file system standard and that are recorded using the system conforming to extended formatting (Joliet and Romeo). When using DVD discs, then along with the above, use discs recorded using the UDF file system. • Folder structure is limited to eight levels and the maximum number of tracks is 3000. However, depending on the folder structure, not all folders and tracks may be recognized and played. MQA Notes regarding specific types of files • Encode WMA files using applications certified by the Microsoft Corporation of the United States. Operation may not be correct if you use uncertified applications. • This unit supports play of AAC files with the extension ".m4a" that have been encoded using iTunes. However, play not be possible if the file has been protected with DRM copy protect (copyright protection) or with some versions of iTunes used for encoding. • WAV files include uncompressed PCM digital audio. • AIFF files include uncompressed PCM digital audio. En 13 > Before Start > Part Names > Install > Playback Advanced Setup | Others Using this unit as a D/A converter You can convert the digital audio of the PC to analog on this unit, and then output it from the ANALOG OUT jacks. 1 Switching the source 1. Press SOURCE of this unit or the remote controller to switch the source of the unit to "USB DAC". USB DAC Connections 2 2. Use an A-B type USB cable to connect a computer. Playback a 14 a USB Cable 3. Start play on the player. • The digital signals that can be input by this unit are linear PCM signals with a sampling frequency and quantization bit rate of 48 kHz/32 bit (operation may not be possible with all connected devices or environments). • Supported OSs of PC to be connected are Windows10® and Mac OS X. • With OSs other than the supported ones, the sound may be interrupted or may not come out. • Depending on the usage environment, playback may not be performed normally. > Before Start > Part Names > Install > Playback Advanced Setup | Others Adjusting sound quality Reproduce the original sound faithfully (DIRECT mode) Processing that affects sound quality is shut down so sound closer to the original is reproduced. (Default Value): OFF 1. Press DIRECT (d). • The DIRECT indicator on the front of the main unit lights when the DIRECT mode is ON. • When the DIRECT mode is ON, DIGITAL OUT is turned OFF. • In DIRECT mode, the display turns off automatically while playing CD or SACD, or connecting USB DAC. • When switching the setting during playback, the audio may be interrupted. DIGITAL FILTER Select one of three types of DIGITAL FILTER. 1. The setting changes each time you press DIGITAL FILTER (a). "SLOW": Soft and fluid sound "SHARP" (Default Value): Sound with more structure and firmness "SHORT": Sound that starts quick and seems to move forward • You can also press SETUP (c) to display the DIGITAL FILTER setting screen from the SETUP menu. In this case, select the setting value with / (b) on the remote controller. • The setting is fixed to "SHORT" while playing MQA-CD or a disc containing music files, or using USB DAC. • When switching the setting during playback, the audio may be interrupted. UP SAMPLING Increasing the sampling frequency helps achieve sound reproduction with a higher degree of clarity. (Default Value): OFF 1. You can also press UP SAMPLING (g) to turn the feature ON and OFF. • This function cannot be used when the DIRECT mode is set to ON or during playback of SACD or DSD. • The setting is fixed to "ON" while playing MQA-CD or a disc containing music files, or using USB DAC. • When switching the setting during playback, the audio may be interrupted. Adjusting the lock range (LOCK RANGE ADJUST) Sound quality is improved by narrowing the lock range to reduce incidental sounds. However, narrowing the lock range too much can cause interruptions to sound and noise. Adjust the lock range while listening to some audio. (Default Value): RANGE 6 1. Press LOCK RANGE (e). 2. Select the setting value with / (f) on the remote controller. "RANGE 6" (broad) to "RANGE 1" (narrow) • You can also press SETUP (c) to display the LOCK RANGE ADJUST setting screen from the SETUP menu. • The setting is fixed to "6" while playing MQA-CD or a disc containing music files, or using USB DAC. • LOCK RANGE ADJUST has no effect on the audio of SACD and DSD. • When switching the setting during playback, the audio may be interrupted. a e b f c d g En 15 > Before Start > Part Names > Install > Playback Advanced Setup | Others Advanced Settings Advanced Setup 1 AUTO STANDBY LOADING MODE This setting places the unit on standby automatically after 20 minutes of inactivity without any audio input. "ON" (Default Value): The unit will automatically enter standby mode. "OFF": The unit will not automatically enter standby mode. The loading time for CD can be shortened. • Activating this function allows loading time to be shortened depending on the CD, however, sound skipping may occur at the beginning of playback. "NORMAL" (Default Value): When the loading time for CD is not shortened "FAST": When the loading time for CD is shortened POWER ON PLAY The unit allows you to configure advanced settings to provide you with an even better experience. 1. Press SETUP on the remote controller. AUTO STANDBY 2. Select the content or the setting with the cursors on the remote controller and press ENTER to confirm your selection. To return to the previous screen, press RETURN. You can set it so that the disc automatically starts playing when this unit is turned on. • By using an externally connected auto timer, you can use timer play when the power automatically switches on. "ON": To play discs automatically "OFF" (Default Value): When discs are not to be played DIGITAL OUT Make settings for digital audio output. When not connecting to the DIGITAL OUT OPTICAL/COAXIAL jack, you can listen to even clearer audio by setting this OFF. "ON" (Default Value), "OFF" DIGITAL FILTER You can select the type of DIGITAL FILTER. (P15) UP SAMPLING Increasing the sampling frequency helps achieve sound reproduction with a higher degree of clarity. (P15) LOCK RANGE ADJUST 3. To exit the settings, press SETUP. 16 Adjust the lock range. (P15) > Before Start > Part Names > Install > Playback Advanced Setup | Others Troubleshooting Others Before starting the procedure ■ The display doesn't light When operation is unstable, problems may be solved by simply turning the power on or to standby or disconnecting/ connecting the power cord, rather than reviewing settings and operations. Try the simple measures on both the unit and the connected device. If the problem isn't fixed after referring to "Troubleshooting", resetting the unit to the status at the time of shipment may solve the problem. • It is possible that the display has been turned off by pressing DISPLAY OFF. Press DISPLAY OFF to turn the display on. Resetting the unit (this resets the unit settings to the default) 1. With the power on and no disc inserted, while pressing and holding g on the main unit, press DIRECT. 2. "CLEAR" is displayed, the unit switches to standby, and the settings are reset. CLEAR ■ Power Cannot turn on the unit • Unplug the power cord from the wall outlet, wait 2 minutes or more, then plug it in again. The unit turns off unexpectedly • The unit automatically switches to standby when the "AUTO STANDBY" setting in the SETUP menu functions. The STANDBY indicator on the main unit continues to flash red and operations are not possible • Unplug the power cord from the wall outlet, wait 2 minutes or more, then plug it in again. The indicator will continue to flash, but press 8 STANDBY/ON on the main unit to turn the main power ON. If this doesn't fix the issue, there may be a malfunction. Unplug the power cord from the wall outlet and contact the dealer or our customer support. ■ Cannot play discs • Place the disc in the disc tray so the label is facing up. • Play may not be possible if the disc is scratched or dirty. • Sound files that are protected by copyright cannot be played. • The disc tray opens if you insert a disc that this unit does not support. ■ Audio Sound is interrupted • Narrowing the lock range too much with the LOCK RANGE ADJUST setting can cause interruptions to sound and also may cause noise. Sound interruptions caused by adjustments to the lock range are not covered by our guarantees of operation. Listen to some audio while adjusting the lock range. There is no digital sound • Set "DIGITAL OUT" in the SETUP menu to "ON". • The audio of SACD and DSD or input from USB DAC is not digital-output. ■ Remote Controller • Make sure that the batteries are installed with the correct polarity. • Install new batteries. Do not mix different types of batteries, or old and new batteries. • Make sure that this unit is not subjected to direct sunshine or inverter-type fluorescent lights. Relocate if necessary. • If this unit is installed in a rack or cabinet with coloredglass doors or if the doors are closed, the remote controller may not work reliably. ■ D/A converter feature • Make sure that the devices are properly connected. • Play audio compatible with the input jacks on this unit. (P14) Cannot play audio from computers • Cancel the muting on your computer. • Select this unit in the audio output settings on your computer. If the source of this unit is set to anything other than "USB DAC", the PC cannot detect this unit. • If there are multiple applications running on the computer, shut down those applications that you are not using. Sampling frequency is always the same through the USB DAC input • Depending on the computer settings, even if the sampling frequencies of the files being played are different, they are converted to the same sampling frequency for output. Computer sounds other than music are heard through the USB DAC input • Depending on the settings on the computer, sounds such as the computer startup tone or error sounds may be played through this unit. ■ SACD • Due to the differences in recording methods, there may be a difference in volume between SACD and CD. En 17 > Before Start > Part Names > Install > Playback Advanced Setup | Others Other notes ■ Discs that can be played MQA-CD SACD (Super Audio CD) (2-channel area only) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Precautions for Playback • Compact discs (CDs) with the following logo on the label surface can be used. Playing hybrid SACD Hybrid SACD consist of two layers; the SACD layer and the CD layer. Press CD/SACD to select the layer you want to listen to. Playing DualDisks "DualDisk" is a disc with video and audio conforming to the DVD standard on one side, and audio that can be played on a CD player on the other. On the audio side that is not the DVD side, play may not always be possible due to the fact that the disc does not conform to the physical specifications of standard CDs. Operations during play Direct search does not work while playing discs with music data. • Note that some discs may not play back because of the disc characteristics, scratches, contamination or the recording state. Playing MQA This unit includes the MQA (Master Quality Authenticated) technology, which enables playback of MQA audio files and streams, delivering the sound of the original master recording. This unit is a CD player that can recognise an MQA-CD. The built-in MQA decoder will restore the high-resolution signal heard in the studio and confirm it, using the authentication signature. Visit www.mqa.co.uk/customer/mqacd for more information. ‘MQA’ or ‘MQA.’ indicates that the product is decoding and playing an MQA stream or file, and denotes provenance to ensure that the sound is identical to that of the source material. ‘MQA.’ indicates it is playing an MQA Studio file, which has either been approved in the studio by the artist/ producer or has been verified by the copyright owner. 18 Types of discs that cannot be played on this unit DVD Video, DVD Audio, CD-G, Video CD, DTS-CD Notes on discs • Be careful not to catch your hand or fingers when opening or closing the disc tray. • Never use discs which have an unusual shape (such as hearts or octagons). These types of discs could jam and damage the unit. • Some audio CDs with copy-control functionality do not comply with official CD standards. These are special discs and cannot be played with this unit. • Do not use discs with residue from cellophane tape, rental discs with labels which are peeling off, or discs with decorative labels. This type of disc could get stuck in the unit, or could damage the unit. • Do not leave a disc having a label printed with an inkjet printer in the unit for a long time. The disc could get stuck in the unit, or could damage the unit. ■ Cleaning the player • Normally, wipe the player with a soft cloth. For tough dirt, apply some neutral detergent diluted in 5 to 6 parts water to a soft cloth, wring out thoroughly, wipe off the dirt, then wipe again with a dry cloth. • Note that getting alcohol, thinner, benzene or insecticide on the player could cause the print and coating to peel off. Also, avoid leaving rubber or vinyl products in contact with the player for long periods of time, as this could damage the cabinet. • When using chemical-impregnated wipes, etc., read the wipe’s cautions carefully. • When dust attached on the disc tray is hard to remove, apply an adhesive tape, etc. to remove the dust. ■ Precautions when moving the unit When moving the unit, remove any discs in it and close the disc tray. Then press 8 STANDBY/ON on the main unit, wait for 10 seconds after [OFF] disappears from the display, and then unplug the power cord. Moving the unit while a disc is still in it may cause damage. ■ Condensation Drops of water can form inside this unit if it is taken from a cold place to a warm room or when a cold room is rapidly warmed by a heater. This is called condensation. This may not only cause the unit to malfunction, but it can also damage the disc or parts of the unit. We recommend removing discs from the unit if it is not to be used for a while. If there is a possibility that condensation has formed, unplug the power cord and allow the unit to stand for at least 3 hours at room temperature. > Before Start > Part Names > Install > Playback Advanced Setup | Others General Specifications ■ Analog Audio Output ■ Other Rated Output Level and Impedance • RCA OUT : 2.3 Vrms (1 kHz, 0 dB) / 100  Control In • Ø3.5 mini-jack (mono) Frequency Response • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Control Out • Ø3.5 mini-jack (mono) Signal to Noise Ratio • CD: 116 dB or more (A-weighting), SACD: 116 dB or more (A-weighting) ■ General THD+N • CD: 0.002 % or less, SACD: 0.002 % or less ■ Digital Audio Input USB DAC • Type B, USB Audio Class 1.0 ■ Digital Audio Output Coaxial Digital Output • RCA Jack, 0.5 Vp-p / 75  Power Supply • AC 220 - 230 V, 50/60 Hz Power Consumption • 43 W • 0.3 W (In Standby) AUTO STANDBY • ON (20 min) / OFF Dimensions (W  H  D) • 435 mm  138 mm  413 mm Weight • 13.1 kg Optical Digital Output • Optical Jack, -14 - -21 dBm / 660 nm En 19 20 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres SUPER AUDIO CD PLAYER PD-50AE Mode d'emploi En Fr Es It De Nl Sv Avant de Démarrer Informations de sécurité ......................................................... 2 Ce que contient la boîte .......................................................... 3 Nom des pièces Panneau frontal ...................................................................... 4 Panneau arrière ...................................................................... 5 Télécommande ....................................................................... 6 Afficheur ................................................................................. 7 Installation Raccordements avec un amplificateur ................................... 8 Branchement du cordon d'alimentation, etc. .........................11 Lecture Lecture de disques ............................................................... 12 Utilisation de cet appareil comme convertisseur D/A ........... 14 Réglage de la qualité du son ................................................ 15 Configuration avancée Configuration avancée........................................................... 16 Autres Dépannage ........................................................................... 17 Autres remarques .................................................................. 18 Caractéristiques générales.................................................... 19 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Informations de sécurité Avant de Démarrer WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR 8QV\PEROHG¶pFODLUÀpFKpGDQVXQWULDQJOHpTXLODWpUDOHVWGHVWLQp jDWWLUHUO¶DWWHQWLRQGHO¶XWLOLVDWHXUVXUOHIDLWTXHFHUWDLQVRUJDQHV LQWHUQHVQRQLVROpVGHO¶DSSDUHLOVRQWWUDYHUVpVSDUXQFRXUDQW pOHFWULTXHDVVH]GDQJHUHX[SRXUFRQVWLWXHUXQUHVTXHG¶pOHFWURFXWLRQ 8QSRLQWG¶H[FODPDWLRQGDQVXQWULDQJOHpTXLODWpUDOHVW GHVWLQpjDWWLUHUO¶DWWHQWLRQGHO¶XWLOLVDWHXUVXUGHVLQVWUXFWLRQV LPSRUWDQWHVUHODWLYHVjO¶HQWUHWLHQHWjO¶XWLOLVDWLRQGXSURGXLW $77(17,21 3285e9,7(572875,648('¶e/(&752&87,211(3$6(1/(9(5/( &289(5&/( 1,/(3$11($8$55,Ê5( $8&81(3,Ê&(5e3$5$%/( 3$5/¶87,/,6$7(851(6(75289(¬/¶,17e5,(85&21),(57287 (175(7,(1¬813(56211(/48$/,),e81,48(0(17 $9(57,66(0(17 3285e9,7(572875,648('¶e/(&752&87,211(3$6 (1/(9(5/(&289(5&/( 1,/(3$11($8$55,Ê5( $8&81( 3,Ê&(5e3$5$%/(3$5/¶87,/,6$7(851(6(75289(¬ /¶,17e5,(85&21),(57287(175(7,(1¬813(56211(/ 48$/,),e81,48(0(17 &HWDSSDUHLOQ¶HVWSDVpWDQFKH3RXUpYLWHUOHVULVTXHVG¶LQFHQGLHHWGH GpFKDUJHpOHFWULTXHQHSODFH]SUqVGHOXLXQUpFLSLHQWUHPSOLG¶HDXWHO TX¶XQYDVHRXXQSRWGHÀHXUVHWQHO¶H[SRVH]SDVjGHVJRXWWHVG¶HDX GHVpFODERXVVXUHVGHODSOXLHRXGHO¶KXPLGLWp 3RXUpYLWHUOHVULVTXHVG¶LQFHQGLHQHSODFH]DXFXQHÀDPPHQXH WHOOH TX¶XQHERXJLHDOOXPpH VXUO¶DSSDUHLO 1¶XWLOLVH]QLQHFRQVHUYH]YRVSLOHVjODOXPLqUHGLUHFWHGXVROHLORX GDQVXQHQGURLWIRUWHPHQWH[SRVpjODFKDOHXUFRPPHXQHYRLWXUHRXj SUR[LPLWpG¶XQDSSDUHLOGHFKDXႇDJH/HVSLOHVULVTXHUDLHQWGHVXLQWHU VXUFKDXႇHUH[SORVHURXV¶HQÀDPPHU/DGXUpHGHYLHHWODSHUIRUPDQFH GHVSLOHVSHXYHQWpJDOHPHQWrWUHUpGXLWHV *DUGH]OHVSLqFHVGHSHWLWHWDLOOHKRUVGHODSRUWpHGHVEpEpVHW GHVHQIDQWV(QFDVG¶LQJHVWLRQDFFLGHQWHOOHYHXLOOH]FRQWDFWHU LPPpGLDWHPHQWXQPpGHFLQ /HVIHQWHVHWRXYHUWXUHVGXFRႇUHWVRQWSUpYXHVSRXUODYHQWLODWLRQ SRXUDVVXUHUXQIRQFWLRQQHPHQWVWDEOHGHO¶DSSDUHLOHWSRXUpYLWHUVD VXUFKDXႇH3RXUpYLWHUOHVULVTXHVG¶LQFHQGLHQHERXFKH]MDPDLVOHV RXYHUWXUHVHWQHOHVUHFRXYUH]SDVG¶REMHWVWHOVTXHMRXUQDX[QDSSHV RXULGHDX[HWQ¶XWLOLVH]SDVO¶DSSDUHLOSRVpVXUXQWDSLVpSDLVRXXQOLW ,O\DXQULVTXHG¶H[SORVLRQVLODEDWWHULHHVWUHPSODFpHSDUXQHDXWUH GHW\SHLQFRUUHFW,OH[LVWHXQULVTXHG¶H[SORVLRQHQFDVGHGpS{WGHOD EDWWHULHGDQVXQIHXRXXQIRXUFKDXGRXHQFRUHHQFDVG¶pFUDVHPHQW RXGHGpFRXSHPpFDQLTXHGHODEDWWHULH 2 3UpFDXWLRQV 9HLOOH]jQ¶LQVWDOOHUFHWDSSDUHLOTXHGDQVXQUDFNRXXQPHXEOHTXL Q¶HQWUDYHSDVODYHQWLODWLRQ /DLVVH]XQHVSDFHOLEUHGHFPDXGHVVXVHWjF{WpGHO¶DSSDUHLODLQVL TXHFPHQIDFHDUULqUH/DIDFHDUULqUHGXUDFNRXGXPHXEOHGRLWVH WURXYHUjFPRXSOXVGXPXUSRXUDVVXUHUXQHDpUDWLRQDGpTXDWHHQ YXHGHGLVVLSHUODFKDOHXU 0LOLHXGHIRQFWLRQQHPHQW 7HPSpUDWXUHHWKXPLGLWpGXPLOLHXGHIRQFWLRQQHPHQW'H&j& GH)j) +XPLGLWpUHODWLYHLQIpULHXUHj RUL¿FHVGH YHQWLODWLRQQRQREVWUXpV 1¶LQVWDOOH]SDVO¶DSSDUHLOGDQVXQHQGURLWPDOYHQWLOpRXXQOLHXVRXPLVj XQHIRUWHKXPLGLWpRXHQSOHLQVROHLO RXjXQHIRUWHOXPLqUHDUWL¿FLHOOH $YLVLPSRUWDQW /HQXPpURGHPRGqOHHWOHQXPpURGHVpULHGHFHWpTXLSHPHQWVRQW VLWXpVjO¶DUULqUHRXHQGHVVRXV1RWH]FHVQXPpURVVXUYRWUHFDUWH GHJDUDQWLHMRLQWHHWFRQVHUYH]ODGDQVXQHQGURLWVUSRXUXQHIXWXUH FRQVXOWDWLRQ $77(17,21 /DWRXFKHLQWHUUXSWHXUGHFHWDSSDUHLOQHFRXSHSDVWRWDOHPHQWOH FRXUDQWSURYHQDQWGHODSULVHVHFWHXU&RPPHOHFRUGRQG¶DOLPHQWDWLRQ IDLWRႈ FHGHGLVSRVLWLIGHGpFRQQH[LRQGXVHFWHXULOGHYUDrWUH GpEUDQFKpDXQLYHDXGHODSULVHVHFWHXUSRXUTXHO¶DSSDUHLOVRLW FRPSOqWHPHQWKRUVWHQVLRQ3DUFRQVpTXHQWYHLOOH]jLQVWDOOHUO¶DSSDUHLO GHWHOOHPDQLqUHTXHVRQFRUGRQG¶DOLPHQWDWLRQSXLVVHrWUHIDFLOHPHQW GpEUDQFKpGHODSULVHVHFWHXUHQFDVG¶DFFLGHQW3RXUpYLWHUWRXWULVTXH G¶LQFHQGLHOHFRUGRQG¶DOLPHQWDWLRQVHUDGpEUDQFKpDXQLYHDXGHOD SULVHVHFWHXUVLYRXVSUpYR\H]XQHSpULRGHSURORQJpHGHQRQXWLOLVDWLRQ SDUH[HPSOHDYDQWXQGpSDUWHQYDFDQFHV &HSURGXLWHVWGHVWLQpjXQHXWLOLVDWLRQGRPHVWLTXHJpQpUDOH7RXWH SDQQHGXHjXQHXWLOLVDWLRQDXWUHTX¶jGHV¿QVSULYpHV FRPPHXQH XWLOLVDWLRQjGHV¿QVFRPPHUFLDOHVGDQVXQUHVWDXUDQWGDQVXQDXWRFDU RXVXUXQEDWHDX HWTXLQpFHVVLWHXQHUpSDUDWLRQVHUDDX[IUDLVGX FOLHQWPrPHSHQGDQWODSpULRGHGHJDUDQWLH $WWHQWLRQFRQFHUQDQWOHFRUGRQG¶DOLPHQWDWLRQ 7HQLUOHFRUGRQG¶DOLPHQWDWLRQSDUODSULVH1HMDPDLVGpEUDQFKHUOD ¿FKHHQWLUDQWVXUOHFRUGRQHWQHMDPDLVWRXFKHUOHFRUGRQG¶DOLPHQWDWLRQ DYHFOHVPDLQVPRXLOOpHVFDUFHODSRXUUDLWFDXVHUXQFRXUWFLUFXLWRXXQH pOHFWURFXWLRQ1HSDVSODFHUO¶DSSDUHLOXQPHXEOHHWFVXUOHFRUGRQ G¶DOLPHQWDWLRQRXFRLQFHUOHFRUGRQ1HMDPDLVIDLUHGHQRHXGDYHFOH FRUGRQRXOHQRXHUDYHFG¶DXWUHVFRUGRQV/HVFRUGRQVG¶DOLPHQWDWLRQ GRLYHQWrWUHDFKHPLQpVGHPDQLqUHjQHSDVSRXYRLUrWUHpFUDVpV8Q FRUGRQG¶DOLPHQWDWLRQHQGRPPDJpSHXWFDXVHUXQLQFHQGLHRXXQH pOHFWURFXWLRQ&RQWU{OHUOHFRUGRQG¶DOLPHQWDWLRQUpJXOLqUHPHQW6¶LOHVW HQGRPPDJpGHPDQGHUDXVHUYLFHDSUqVYHQWHDXWRULVpOHSOXVSURFKH RXDXUHYHQGHXUGHOHUHPSODFHU $77(17,21 &HWDSSDUHLOHVWXQSURGXLWODVHUGH&ODVVHFODVVpVHORQO¶DUWLFOH,(& UHODWLIjOD6pFXULWpGHVSURGXLWVODVHU APPAREIL À LASER DE CLASSE 1 ,QIRUPDWLRQjGHVWLQDWLRQGHVXWLOLVDWHXUVVXUODFROOHFWH HWO¶pOLPLQDWLRQGHVpTXLSHPHQWVHWEDWWHULHVXVDJpV Marquage pour les équipements Exemples de marquage pour les batteries Pb &HVV\PEROHVTXL¿JXUHQWVXUOHVSURGXLWVOHVHPEDOODJHVHWRX OHVGRFXPHQWVG¶DFFRPSDJQHPHQWVLJQL¿HQWTXHOHVpTXLSHPHQWV pOHFWULTXHVHWpOHFWURQLTXHVHWEDWWHULHVXVDJpVQHGRLYHQWSDVrWUH MHWpVDYHFOHVGpFKHWVPpQDJHUVHWIRQWO¶REMHWG¶XQHFROOHFWHVpOHFWLYH 3RXUDVVXUHUO¶HQOqYHPHQWHWOHWUDLWHPHQWDSSURSULpVGHVSURGXLWVHW EDWWHULHVXVDJpVPHUFLGHOHVUHWRXUQHUGDQVOHVSRLQWVGHFROOHFWH VpOHFWLYHKDELOLWpVFRQIRUPpPHQWjODOpJLVODWLRQORFDOHHQYLJXHXU (QUHVSHFWDQWOHVFLUFXLWVGHFROOHFWHVpOHFWLYHPLVHQSODFHSRXUFHV SURGXLWVYRXVFRQWULEXHUH]jpFRQRPLVHUGHVUHVVRXUFHVSUpFLHXVHV HWjSUpYHQLUOHVLPSDFWVQpJDWLIVpYHQWXHOVVXUODVDQWpKXPDLQHHW O¶HQYLURQQHPHQWTXLSRXUUDLHQWUpVXOWHUG¶XQHPDXYDLVHJHVWLRQGHVGpFKHWV 3RXUSOXVG¶LQIRUPDWLRQVXUODFROOHFWHHWOHWUDLWHPHQWGHVSURGXLWV HWEDWWHULHVXVDJpVYHXLOOH]FRQWDFWHUYRWUHPXQLFLSDOLWpYRWUH VHUYLFHGHJHVWLRQGHVGpFKHWVRXOHSRLQWGHYHQWHFKH]TXLYRXV DYH]DFKHWpFHVSURGXLWV &HVV\PEROHVQHVRQWYDODEOHVTXHGDQVOHVSD\VGHO¶8QLRQ (XURSpHQQH 3RXUOHVSD\VQ¶DSSDUWHQDQWSDVjO¶8QLRQ(XURSpHQQH 6LYRXVVRXKDLWH]MHWHUFHVDUWLFOHVYHXLOOH]FRQWDFWHUOHVDXWRULWpV RXUHYHQGHXUVORFDX[SRXUFRQQDvWUHOHVPpWKRGHVG¶pOLPLQDWLRQ DSSURSULpHV :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Ce que contient la boîte 1. 2. 3. 4. • 1 2 3 Appareil principal (1) Télécommande (RC-980C) (1), Piles (AAA/R03) (2) Câble audio analogique (Pour le test) (1) Cordon d'alimentation (1) Mode d'emploi (ce document) (1) • Le cordon d'alimentation devra être branché uniquement lorsque tous les autres raccordements seront effectués. • Nous n’acceptons en aucun cas la responsabilité des dommages résultant d'une connexion à des équipements fabriqués par d'autres sociétés. • Les spécifications et l'aspect peuvent changer sans préavis. La mise sous tension ou hors tension ne peut pas être effectuée avec la télécommande. Utiliser la touche 8 STANDBY/ON de l'appareil principal. 4 Fr 3 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Panneau frontal Nom des pièces 1 6 2 3 7 8 9 1. 8 Touche/témoin STANDBY/ON : Permet de mettre l'appareil sous tension ou hors tension. Lors du démarrage de l'appareil, le témoin au centre de la touche est bleu. 2. Témoin STANDBY : Est rouge lorsque l'appareil est en mode veille. 3. Plateau du disque : Déposez les disques ici. Vous pouvez également utiliser des disques de 8 cm. 4. Touche ; : Permet d'ouvrir ou de fermer le plateau à disque. 5. Touches Lecture : u t : Permet de revenir au début de la piste en cours de lecture. Appuyer une nouvelle fois pour aller sur la piste précédente. Appuyer longuement pour revenir rapidement en arrière. q/h : Permet de lire ou de mettre en pause. y i : Si elle est pressée durant la lecture, permet d'aller sur la piste suivante. Appuyer longuement pour avancer rapidement dans la piste. g : Cette touche permet d'arrêter la lecture. 4 4 5 bk bl 6. Capteur de la télécommande • La plage de réception de la télécommande est d'environ 16´/5 m, à un angle de 20° dans la direction verticale et à un angle de 30° à gauche et à droite. 7. Touche/témoin CD/SACD : Permet de choisir la source entre CD/SACD. Si vous lisez un SACD hybride, la couche en cours de lecture change lorsque vous appuyez sur ceci. (P18) Le témoin est bleu lorsque SACD est sélectionné. 8. Touche/témoin DIRECT : Permet d'activer ou de désactiver le mode DIRECT. (P15) Le témoin est bleu lorsque le mode DIRECT est activé. 9. Afficheur (P7) 10.Touche SOURCE : Permet de changer la source à lire. 11. Touche SETUP : Affiche le menu SETUP. (P16) > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Panneau arrière 1 2 3 4 5 1. Prise ANALOG OUT : Utilisez un câble audio analogique pour connecter un amplificateur intégré, par exemple. 2. AC IN : Permet de brancher le cordon d'alimentation fourni. 3. Port USB DAC : Permet d'utiliser un câble USB (type A-B) pour raccorder un ordinateur. 4. Prise DIGITAL OUT OPTICAL/COAXIAL : Permet d'utiliser un câble optonumérique ou un câble coaxial numérique pour raccorder un amplificateur intégré, par exemple. 5. Prise CONTROL IN/OUT : En y raccordant des amplificateurs et des périphériques audio de marque Pioneer, le contrôle centralisé est possible. Vous pouvez, par exemple, contrôler les amplificateurs et les périphériques audio. Fr 5 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Télécommande 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. Touche ^ STANDBY/ON : Lorsque l'appareil est sous tension, ceci permet de mettre l'appareil en marche ou en veille. La mise sous tension ou hors tension ne peut pas être effectuée avec la télécommande. 2. Touche SHUFFLE : Permet de sélectionner la lecture aléatoire. (P13) 3. Touche REPEAT : Permet de sélectionner la répétition de lecture. (P13) 4. Touches numérotées : Permet de saisir directement le numéro de la piste d'un CD lors du choix des pistes. Elles sont également utilisées pour saisir les numéros de piste de la lecture programmée. 5. Touche CLEAR : Permet d'effacer le contenu défini pour la lecture programmée. (P13) 6. Touche DIGITAL FILTER : Permet de sélectionner l'un des trois types de DIGITAL FILTER. (P15) 7. Touches du curseur et ENTER : Permet de sélectionner l'élément à l'aide des touches du curseur et d'appuyer sur ENTER pour valider. 8. Touche SETUP : Affiche le menu SETUP. (P16) 9. Touches Lecture : u : Permet de revenir au début de la piste en cours de lecture. Appuyer une nouvelle fois pour aller sur la piste précédente. /h : Lecture ou pause. i : Passer à la piste suivante. t : Appuyer longuement pour revenir rapidement en arrière dans la piste en cours de lecture. g : Arrêter la lecture. y : Appuyer longuement pour avancer rapidement dans la piste en cours de lecture. 10.Touche SOURCE: Permet de changer la source à lire. 11. Touche DIRECT : Permet d'activer ou de désactiver le mode DIRECT. (P15) 12.Touche DISPLAY : Permet de modifier les informations présentes sur l'afficheur. • Selon la source, il se peut que la commande ne se lance pas. 13.Touche ; OPEN/CLOSE : Permet d'ouvrir ou de fermer le plateau à disque. 14.Touche PROGRAM : Utilisée pour la lecture programmée. (P13) 15.Touche LOCK RANGE : Permet d'afficher l'écran des paramètres LOCK RANGE ADJUST. (P15) 16.Touche RETURN : Permet à l'affichage de retourner à son état précédent. 17.Bouton UP SAMPLING : Commutez la fonction UP SAMPLING sur ON et OFF. (P15) 18.Touche CD/SACD : Permet de choisir la source entre CD/SACD. Si vous lisez un SACD hybride, la couche en cours de lecture change lorsque vous appuyez sur ceci. (P18) 19.Touche DIGITAL OUT : Permet d'activer ou de désactiver la sortie numérique. (P16) 20.Touche DISPLAY OFF : Appuyer pour éteindre l'afficheur de cet appareil. Appuyer une nouvelle fois pour allumer l'afficheur. 21.Touche DIMMER : Permet de régler la luminosité de l'afficheur sur trois niveaux. (Valeur par défaut : Niveau 3) Faire correspondre la polarité en insérant les piles. > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Afficheur 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Est allumé durant la lecture d'un SACD et du format DSD. 2. Afficheur des messages : Permet d'afficher les informations des pistes et des menus. 3. S'allume lorsque les commandes à l'aide des touches du curseur de la télécommande sont possibles. 4. Affiche l'état de la lecture. 5. S'allume lorsque le paramètre de la sortie audio numérique est activé. (P16) 6. S'allume pour montrer des éléments tels que la durée restante d'une piste ou d'un disque, ou la durée totale du disque. 7. S’affiche lorsqu’un flux ou un fichier MQA est lu. Pour des détails, consultez "Lecture MQA". (P18) Fr 7 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Raccordements avec un amplificateur Installation Cet appareil 1 a 2 1 a 2 a Amplificateur intégré, récepteur AV, etc. Écoutez le son provenant des disques lus par cet appareil et des périphériques raccordés à celui-ci par les systèmes d'enceintes raccordés à des amplificateurs intégrés ou à des récepteurs AV. Raccordez selon les prises d'entrée de votre amplificateur. 8 a Câble audio analogique Raccordement à l'aide d'un câble audio analogique Le signal est converti en analogique par le convertisseur D/A de cet appareil puis reproduit vers un amplificateur intégré, par exemple. Raccordez les prises LINE IN d'un amplificateur intégré à la prise ANALOG OUT (prise RCA) de cet appareil. > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Raccordement à l'aide d'un câble optonumérique Raccordement à l'aide d'un câble coaxial numérique Le signal est converti en analogique par le convertisseur D/A de l'amplificateur intégré, par exemple. Raccordez la prise OPTICAL IN d'un amplificateur intégré à la prise DIGITAL OUT OPTICAL de cet appareil. • L’audio du SACD et du DSD ou l’entrée du USB DAC ne sont pas restitués à partir de la prise DIGITAL OUT OPTICAL de cette unité. Le signal est converti en analogique par le convertisseur D/A de l'amplificateur intégré, par exemple. Raccordez la prise COAXIAL IN d'un amplificateur intégré à la prise DIGITAL OUT COAXIAL de cet appareil. • L’audio du SACD et du DSD ou l’entrée du USB DAC ne sont pas restitués à partir de la prise DIGITAL OUT COAXIAL de cette unité. • Les signaux numériques pouvant être reproduits par cet appareil sont des signaux PCM linéaires avec une fréquence d'échantillonnage et un débit de quantification de 192 kHz/24 bits (Le fonctionnement pourrait ne pas être possible avec tous les périphériques raccordés ou tous les environnements). • Les signaux numériques pouvant être reproduits par cet appareil sont des signaux PCM linéaires avec une fréquence d'échantillonnage et un débit de quantification de 192 kHz/24 bits (Le fonctionnement pourrait ne pas être possible avec tous les périphériques raccordés ou tous les environnements). Fr 9 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres La prise de contrôle Si vous possédez plusieurs appareils de marque Pioneer et que ceux-ci sont munis de prises CONTROL IN/OUT, vous pouvez tous les contrôler par le biais du capteur de télécommande de l'amplificateur, par exemple. En branchant des câbles de connexion avec mini-prise monophonique (sans résistance) comme montré sur le schéma, même si cet appareil et les autres périphériques sont placés à des endroits où la réception du signal de la télécommande est impossible, vous pouvez toujours utiliser la télécommande pour les contrôler en la pointant vers le capteur de télécommande de l'amplificateur, par exemple. • Assurez-vous d'effectuer également le raccordement avec le câble audio analogique. Le contrôle centralisé ne peut pas fonctionner correctement avec seulement le raccordement de la prise de contrôle. • Le capteur de télécommande présent sur cet appareil arrête de fonctionner si vous raccordez un câble de connexion avec mini-prise monophonique (sans résistance) à la prise CONTROL IN de cet appareil. • Les capteurs de télécommande présents sur les autres appareils arrêtent de fonctionner si vous raccordez un câble de connexion avec mini-prise monophonique (sans résistance) à la prise CONTROL OUT de cet appareil. • Si un lecteur réseau et un amplificateur de marque Pioneer sont raccordés par la prise CONTROL IN/OUT, vous pouvez effectuer les commandes de base sur cet appareil, le lecteur réseau et l'amplificateur à l'aide d'une application pour smartphone par le biais du réseau. 10 (Un exemple de raccordement) IN OUT CONTROL a Amplificateur a Cet appareil IN OUT CONTROL Périphérique audio a Câbles de connexion avec mini-prise monophonique (sans résistance) > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Branchement du cordon d'alimentation, etc. 1 Branchement du cordon d'alimentation 2 a a a Cordon d’alimentation Ce modèle dispose d’un cordon d’alimentation amovible. Le cordon d'alimentation doit être connecté uniquement lorsque toutes les autres connexions sont effectuées. Assurez-vous de brancher d'abord le cordon d'alimentation à la prise AC IN de l'appareil puis de le brancher à la prise d'alimentation. Toujours débrancher de la prise en premier lorsque vous retirez le cordon d'alimentation. Démarrage Appuyez sur la touche 8 STANDBY/ON de l'appareil principal. • Appuyez jusqu'à ce que la touche reste enfoncée. Lors du démarrage de l'appareil, le témoin 8 STANDBY/ON au centre de la touche est bleu. Fr 11 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Lecture de disques Lecture 1 Consultez la (P18) pour savoir quels disques vous pouvez lire avec cet appareil. Lecture de CD musicaux Effectuez la procédure suivante lorsque l'appareil est en marche. 1. Appuyez sur la touche CD/SACD de la télécommande pour régler la source sur CD/SACD. 2. Appuyez sur la touche ; de l'appareil principal pour ouvrir le plateau à disque et, après avoir introduit un disque, appuyez une nouvelle fois sur ; pour fermer le plateau. 3. Appuyez sur la touche /h (g) de la télécommande pour démarrer la lecture. 4. Utilisez les touches de lecture (h) pour arrêter la lecture ou choisir les pistes à lire. Vous pouvez également effectuer la sélection en saisissant le numéro de la piste à l'aide des touches numérotées (b). Pour saisir un numéro de piste à 2 chiffres, appuyez plusieurs fois sur la touche +10 comme valeur du second chiffre (dizaines), puis appuyez sur la valeur du premier chiffre. Si vous appuyez sur DISPLAY (d), vous pouvez modifier ce qui apparait sur l'afficheur pour montrer la durée écoulée ou restante du disque, etc. • Le contenu affiché dépend du disque. 2 12 • L'affichage du nom de la piste est uniquement pris en charge pour les fichiers musicaux aux formats MP3/WMA/ FLAC/AAC (M4A uniquement)/DSD (DSF uniquement). • Les caractères qui ne peuvent pas être affichés par cet appareil sont remplacés par "". a e b c f Lecture d'un disque avec fichiers musicaux Effectuez la procédure suivante lorsque l'appareil est en marche. 1. Appuyez sur la touche CD/SACD de la télécommande pour régler la source sur CD/SACD. 2. Appuyez sur la touche ; de l'appareil principal pour ouvrir le plateau à disque et, après avoir introduit un disque, appuyez une nouvelle fois sur ; pour fermer le plateau. 3. Appuyez sur la touche /h (g) de la télécommande pour démarrer la lecture. 4. Utilisez les touches de lecture (h) pour arrêter la lecture ou choisir les pistes à lire. Si vous appuyez sur DISPLAY (d), vous pouvez modifier ce qui apparait sur l'afficheur pour montrer la durée écoulée ou restante du disque, le nom de fichier de la piste, ou bien le nom de la piste, etc. • Le contenu affiché dépend du disque et du fichier. g h d > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Répétition de lecture Caractéristiques des fichiers pouvant être lus 1. Appuyez plusieurs fois sur REPEAT (a) pendant la lecture pour faire apparaitre ALL ou 1 sur l'afficheur. ALL : Permet de répéter la lecture de toutes les pistes. 1 : Permet de répéter la lecture de la piste en cours de lecture. Pour annuler la lecture en boucle, appuyez plusieurs fois sur REPEAT (a) pour faire apparaitre OFF sur l’affichage. MP3 44,1/48 kHz WMA 44,1/48 kHz Lecture aléatoire AAC 44,1/48/88,2/96 kHz 1. Appuyez sur SHUFFLE (f) durant la lecture ou un arrêt pour afficher sur l’affichage. : Permet de lire aléatoirement toutes les pistes. Pour annuler la lecture aléatoire, appuyez sur SHUFFLE (f) pour faire apparaitre OFF sur l’affichage. Lecture programmée Vous pouvez choisir l'ordre de lecture des pistes d'un CD. 1. Appuyez sur PROGRAM (e) pendant l'arrêt. "P00" s'affiche si rien n'a été mémorisé. Saisissez le numéro de la piste que vous désirez mémoriser à l'aide des touches numérotées (b). Pour saisir un numéro de piste à 2 chiffres, appuyez plusieurs fois sur la touche +10 comme valeur du second chiffre (dizaines), puis appuyez sur la valeur du premier chiffre. Le numéro dans "P00" augmente chaque fois que vous mémorisez une piste. Il est possible de mémoriser jusqu'à 24 pistes. • Pour lire le programme mémorisé, appuyez sur la touche /h (g) de la télécommande. • Si vous appuyez sur la touche CLEAR (c) durant la mémorisation des pistes, les pistes sont effacées dans l'ordre, en commençant par celle que vous avez mémorisée en dernier. • Si vous appuyez sur la touche PROGRAM (e) durant la mémorisation des pistes, toutes les pistes que vous avez mémorisées sont effacées. • Si la durée totale de lecture du programme enregistré dépasse 99 minutes 59 secondes, " : " apparait sur l’affichage. Taux d'échantillonnage WAV AIFF FLAC ALAC DSD 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 2,8/5,6 MHz Débits binaires Entre 8 kbps, 320 kbps et VBR. Entre 5 kbps, 192 kbps et VBR. Entre 8 kbps, 320 kbps et VBR. Bits de quantification Types de disques pouvant être lus CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW Extension – .mp3 – .wma – * .aac/ .m4a – 8/16/24 bits * .wav – 8/16/24 bits * .aif/ .aiff – 8/16/24 bits * .flac – 8/16/24 bits * .m4a – 1 bits – .dsf/ .dff .flac/ .wav 44,1/48/88,2/96/176,4/ * – 8/16/24 bits 192/352,8/384 kHz * Pour lire des fichiers dépassant 48 kHz, utilisez ceux enregistrés sur un DVD. Remarques à propos de tous les types de fichiers • Utilisez des disques CD/CD-R/CD-RW conformes à la norme du système de fichiers sur CD-ROM ISO9660 niveau 1/ niveau 2 et qui ont été enregistrés à l'aide du système de format étendu (Joliet et Romeo). Si vous désirez utiliser des DVD, avec ce qui précède, utilisez des disques enregistrés à l'aide du système de fichiers UDF. • La structure de dossier est limitée à huit niveaux et à un nombre maximum de 3000 pistes. Cependant, en fonction de la structure du dossier, tous les dossiers et toutes les pistes pourraient ne pas pouvoir être lus. MQA Remarques à propos de types spécifiques de fichiers • Encodez des fichiers WMA à l'aide d'applications certifiées par la société Microsoft des États-Unis. Le fonctionnement pourrait ne pas être bon si vous utilisez des applications non certifiées. • Cet appareil prend en charge la lecture des fichiers AAC ayant l'extension ".m4a" encodés à l'aide d'iTunes. Cependant, la lecture pourrait être impossible si le fichier a été protégé contre la copie par DRM (protection du droit d'auteur) ou avec certaines versions d'iTunes utilisées pour l'encodage. • Les fichiers WAV comprennent des données audio numériques PCM non compressées. • Les fichiers AIFF comprennent des données audio numériques PCM non compressées. Fr 13 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Utilisation de cet appareil comme convertisseur D/A Vous pouvez convertir l’audio numérique du PC en analogique sur cette unité, puis le restituer à partir des prises ANALOG OUT. 1 Changement de la source 1. Appuyez sur SOURCE sur cette unité ou sur la télécommande pour commuter la source de l’unité sur "USB DAC". USB DAC 2 Connexions 2. Utilisez un câble USB de type A-B pour raccorder un ordinateur. Lecture a 14 a Câble USB 3. Démarrez la lecture sur le lecteur. • Les signaux numériques entrant par cet appareil sont des signaux PCM linéaires avec une fréquence d'échantillonnage et un débit de quantification de 48 kHz/ 32 bits (Le fonctionnement pourrait ne pas être possible avec tous les périphériques raccordés ou tous les environnements). • Les SE supportés du PC à connecter sont Windows10® et Mac OS X. • Avec des SE différents de ceux supportés, le son risque d’être interrompu ou de ne pas être émis. • Selon l’environnement d’utilisation, la lecture risque de ne pas être effectuée normalement. > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Réglage de la qualité du son Reproduire fidèlement le son original (mode DIRECT) Le traitement qui affecte la qualité audio est désactivé ce qui fait qu'un son proche de l'original est reproduit. (Valeur par défaut) : OFF 1. Appuyez sur DIRECT (d). • Le témoin DIRECT à l'avant de l'appareil principal s'allume lorsque le mode DIRECT est sur ON. • Lorsque le mode DIRECT est sur ON, DIGITAL OUT est mis sur OFF. • En mode DIRECT, l’affichage s’éteint automatiquement lors de la lecture d’un CD ou d’un SACD, ou d’une connexion USB DAC. • L’audio risque d’être interrompu en cas de changement de réglage durant la lecture. DIGITAL FILTER Permet de sélectionner l'un des trois types de DIGITAL FILTER. 1. Le paramètre change chaque fois que vous appuyez sur DIGITAL FILTER (a). "SLOW" : Son doux et fluide "SHARP" (Valeur par défaut) : Son ayant davantage de structure et de fermeté "SHORT" : Son qui démarre rapidement et donne l'impression d'un déplacement vers l'avant • Vous pouvez également appuyer sur SETUP (c) pour afficher l'écran de réglage DIGITAL FILTER depuis le menu SETUP. Dans ce cas, sélectionnez la valeur de réglage à l'aide des touches / (b) de la télécommande. • Le réglage est fixé sur "SHORT" lors de la lecture d’un MQA-CD ou d’un disque contenant des fichiers musicaux, ou de l’utilisation de USB DAC. • L’audio risque d’être interrompu en cas de changement de réglage durant la lecture. UP SAMPLING L'augmentation de la fréquence d'échantillonnage aide à obtenir une reproduction sonore ayant un degré plus élevé de clarté. (Valeur par défaut) : OFF 1. Vous pouvez également appuyez sur UP SAMPLING (g) pour régler la fonction sur ON et OFF. • Cette fonction ne peut pas être utilisée lorsque le mode DIRECT est réglé sur ON ou durant la lecture d’un SACD ou d’un DSD. • Le réglage est fixé sur "ON" lors de la lecture d’un MQA-CD ou d’un disque contenant des fichiers musicaux, ou de l’utilisation de USB DAC. • L’audio risque d’être interrompu en cas de changement de réglage durant la lecture. Réglage de la plage de verrouillage (LOCK RANGE ADJUST) • L’audio risque d’être interrompu en cas de changement de réglage durant la lecture. a e b f c d g La qualité du son est améliorée par la réduction de la plage de verrouillage minimisant les bruits de fond. Cependant, une réduction trop importante de la plage de verrouillage peut causer des coupures du son et des parasites sonores. Réglez la plage de verrouillage tout en écoutant du son. (Valeur par défaut) : RANGE 6 1. Appuyez sur LOCK RANGE (e). 2. Sélectionnez la valeur de réglage à l'aide des touches / (f) de la télécommande. "RANGE 6" (large) à "RANGE 1" (étroit) • Vous pouvez également appuyer sur SETUP (c) pour afficher l'écran de réglage LOCK RANGE ADJUST depuis le menu SETUP. • Le réglage est fixé sur "6" lors de la lecture d’un MQA-CD ou d’un disque contenant des fichiers musicaux, ou de l’utilisation de USB DAC. • LOCK RANGE ADJUST n'a aucun effet sur le son du SACD et du format DSD. Fr 15 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Configuration avancée Configuration avancée 1 AUTO STANDBY LOCK RANGE ADJUST Ce réglage met automatiquement l’appareil en veille après 20 minutes d’inactivité sans aucune entrée audio. "ON" (Valeur par défaut) : L’appareil passera automatiquement en mode veille. "OFF" : L'appareil ne passe pas automatiquement en mode veille. Réglage de la plage de verrouillage. (P15) POWER ON PLAY L'appareil vous permet de configurer les paramètres avancés pour qu'ils vous fournissent une expérience encore meilleure. 1. Appuyez sur SETUP de la télécommande. Vous pouvez le régler pour que le disque démarre automatiquement la lecture lorsque cet appareil est mis en marche. • En utilisant une minuterie automatique externe, vous pouvez utiliser la lecture en mode minuterie lors de la mise automatique sous tension. "ON" : Pour lire automatiquement des disques "OFF" (Valeur par défaut) : Lorsqu'aucun disque ne doit être lu AUTO STANDBY 2. Sélectionnez le contenu ou le paramètre avec les touches du curseur de la télécommande et appuyez sur ENTER pour valider votre sélection. Pour retourner à l'écran précédent, appuyez sur RETURN. DIGITAL OUT Effectuez les réglages pour la sortie audio numérique. Si la prise DIGITAL OUT OPTICAL/COAXIAL n'est pas raccordée, vous pouvez entendre un son encore plus clair en réglant ceci sur OFF. "ON" (Valeur par défaut), "OFF" DIGITAL FILTER Vous pouvez choisir le type de DIGITAL FILTER. (P15) UP SAMPLING 3. Pour quitter les réglages, appuyez sur SETUP. 16 L'augmentation de la fréquence d'échantillonnage aide à obtenir une reproduction sonore ayant un degré plus élevé de clarté. (P15) LOADING MODE Il est possible de raccourcir le temps de chargement d’un CD. • L’activation de cette fonction permet de raccourcir le temps de chargement selon le CD, cependant, le son risque de sauter au début de la lecture. "NORMAL" (Valeur par défaut) : Lorsque le temps de chargement du CD n’est pas raccourci "FAST" : Lorsque le temps de chargement du CD est raccourci > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Dépannage Autres Avant de démarrer la procédure Lorsque le fonctionnement est instable, les problèmes peuvent être résolus simplement en mettant l'appareil sous tension ou en veille, ou en débranchant/rebranchant le cordon d'alimentation, plutôt qu'en passant en revue les réglages et les commandes. Essayez d'effectuer les mesures les plus simples à la fois sur l'appareil et sur le périphérique connecté. Si consulter "Dépannage" ne résout pas le problème, réinitialiser l'appareil dans l'état dans lequel il était au moment de l'achat peut le résoudre. Réinitialisation de l'appareil (ceci réinitialise les paramètres de cet appareil sur leur valeur par défaut) 1. Avec l'appareil en marche et aucun disque présent, appuyez longuement sur la touche g de l'appareil principal, en même temps que sur DIRECT. 2. "CLEAR" s'affiche, l'appareil se met en veille et les réglages sont réinitialisés. CLEAR ■ Alimentation Impossible d'allumer cet appareil • Débranchez le cordon d'alimentation de la prise murale, attendez au moins 2 minutes, puis rebranchez-le une nouvelle fois. L'appareil s'éteint de manière inattendue • L'appareil passe automatiquement en mode veille lorsque le paramètre "AUTO STANDBY" dans les fonctions du menu SETUP. Le témoin STANDBY sur l'appareil principal continue de clignoter en rouge et aucune action n'est possible. • Débranchez le cordon d'alimentation de la prise murale, attendez 2 minutes ou plus, puis branchez-le une nouvelle fois. Le témoin continue de clignoter, mais appuyez sur la touche 8 STANDBY/ON de l'appareil principal pour mettre sur ON. Si cela ne règle pas le problème, il pourrait y avoir un dysfonctionnement. Débranchez le cordon d'alimentation de la prise murale et contactez le revendeur ou notre service après-vente. • Il est possible que l'afficheur ait été éteint par une pression sur DISPLAY OFF. Appuyez sur la touche DISPLAY OFF pour allumer l'afficheur. types de piles ou des piles neuves et usagées. • Assurez-vous que cet appareil n'est pas exposé à la lumière directe du soleil ou à un éclairage fluorescent inverseur. Déplacez à nouveau si nécessaire. • Si cet appareil est installé sur une étagère ou dans un meuble avec des portes en verre teinté ou si les portes sont fermées, la télécommande peut ne pas fonctionner correctement. ■ Impossible de lire des disques ■ Fonctionnalité convertisseur D/A • Placez le disque sur le plateau en mettant l'étiquette vers le haut. • La lecture peut ne pas être possible si le disque est rayé ou sale. • Les fichiers audio qui sont protégés par droits d'auteur ne peuvent pas être lus. • Le plateau à disque s'ouvre si vous introduisez un disque que cet appareil ne prend pas en charge. • Assurez-vous que les périphériques sont correctement raccordés. • Lisez le son compatible avec les prises d'entrée de cet appareil. (P14) ■ L'afficheur ne s'allume pas ■ Audio Le son est interrompu • Une réduction trop importante de la plage de verrouillage avec le paramètre LOCK RANGE ADJUST peut causer des coupures du son ainsi que des parasites sonores. Les coupures du son causées par des réglages de la plage de verrouillage ne sont pas couvertes par notre garantie de fonctionnement. Écoutez du son pendant le réglage de la plage de verrouillage. Il n'y a pas de son numérique • Réglez "DIGITAL OUT" dans le menu SETUP sur "ON". • L’audio du SACD et du DSD ou l’entrée du USB DAC ne sont pas restitués en numérique. ■ Télécommande • Assurez-vous que les piles ont été insérées en respectant la polarité. • Insérez des piles neuves. Ne mélangez pas différents Impossible de lire le son provenant des ordinateurs • Annulez la sourdine sur votre ordinateur. • Sélectionnez cet appareil dans les paramètres de sortie audio sur votre ordinateur. Si la source de cette unité est réglé sur autre chose que "USB DAC", le PC ne peut pas détecter cette unité. • Si plusieurs applications tournent sur l'ordinateur, quittez les applications que vous n'utilisez pas. La fréquence d'échantillonnage est toujours la même par le biais de l'entrée USB DAC • En fonction des paramètres de l'ordinateur, même si les fréquences d'échantillonnage des fichiers en cours de lecture sont différentes, elles sont converties vers la même fréquence d'échantillonnage pour la sortie. Les sons de l'ordinateur autres que la musique sont audibles au travers de l'entrée USB DAC • En fonction des paramètres de l'ordinateur, les sons comme les bips de démarrage ou d'erreurs peuvent être lus par le biais de cet appareil. ■ SACD • À cause des différences dans les méthodes d'enregistrement, il peut y avoir une différence de volume entre un SACD et un CD. Fr 17 > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Autres remarques ■ Disques pouvant être lus MQA-CD SACD (Super Audio CD) (Zone 2 canaux uniquement) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Précautions pour la lecture • Les disques compacts (CD) dont la surface comporte le logo suivant peuvent être utilisés. • Notez que certains disques peuvent ne pas être lus en raison de leurs caractéristiques, de la présence de rayures, de saleté ou de l’état de l’enregistrement. Lecture MQA Cette unité inclut la technologie MQA (Master Quality Authenticated), qui permet la lecture flux et de fichiers audio MQA, restituant le son de l’enregistrement d’origine. Cette unité est un lecteur CD pouvant reconnaitre un MQA-CD. Le décodeur MQA intégré rétablira le signal haute résolution entendu en studio et le confirmera, en utilisant la signature d’authentification. Rendez-vous sur www.mqa.co.uk/customer/mqacd pour plus d’informations. ‘MQA’ ou ‘MQA.’ indiquent que le produit est en train de décoder et de lire un flux ou un fichier MQA, et indique la provenance pour assurer que le son est identique à celui du matériel source. ‘MQA.’ indique la lecture d’un fichier MQA Studio, qui a été approuvé en studio par l’artiste/le producteur ou qui a été vérifié par le propriétaire des droits d’auteur. 18 Lecture d'un SACD hybride Un SACD hybride est constitué de deux couches; la couche SACD et la couche CD. Appuyez sur CD/SACD pour sélectionner la couche que vous souhaitez écouter. ■ Nettoyage du lecteur La recherche directe ne fonctionne pas durant la lecture de disques avec des données musicales. • Normalement, essuyez le lecteur avec un chiffon doux. Pour enlever les taches rebelles, imprégnez le chiffon d’un détergent neutre dilué dans 5 à 6 fois plus d’eau, tordez bien le chiffon, essuyez la saleté, puis passez un chiffon sec sur lecteur. • Notez que les inscriptions et le revêtement du lecteur peuvent être endommagés par l’alcool, les diluants, le benzène et les insecticides. Évitez aussi de laisser des produits en caoutchouc ou en vinyle très longtemps au contact du lecteur, car ils pourraient endommager le coffret. • Lorsque vous utilisez des lavettes imprégnées de produit chimique, etc. lisez attentivement les précautions à prendre. • Lorsque de la poussière sur le plateau à disque est difficile à enlever, appliquez du ruban adhésif, etc. pour enlever la poussière. Types de disques ne pouvant pas être lus par cet appareil ■ Précautions lors du déplacement de l'appareil Lecture des DualDisk Le "DualDisk" est un disque comportant de la vidéo et du son conformément à la norme DVD sur un côté, et du son pouvant être lu sur un lecteur CD de l'autre. Sur le côté audio qui n'est pas le côté DVD, la lecture pourrait ne pas être toujours possible du fait que le disque n'est pas conforme aux caractéristiques physiques des CD habituels. Commandes durant la lecture DVD Video, DVD Audio, CD-G, Video CD, DTS-CD Remarques sur les disques • Veillez à ne pas vous coincer les mains ou les doigts en ouvrant ou en fermant le plateau à disque. • N'utilisez jamais de disques ayant des formes inhabituelles (octogonales ou en forme de cœur par exemple). Ce type de disques peut se coincer et endommager l'appareil. • Certains CD audio comportant la fonctionnalité « Copy Control » ne répondent pas aux normes officielles en matière de CD. Il s’agit de disques spéciaux qui ne peuvent pas être lus sur cet appareil. • N'utilisez pas de disques avec des résidus de ruban adhésif, des disques de location avec des étiquettes qui se décollent, ou des disques avec des étiquettes décoratives. Ce type de disque peut rester coincé dans l'appareil, ou endommager l'appareil. • Ne laissez pas un disque dont l’étiquette a été imprimée avec une imprimante à jet d'encre dans l’appareil pendant une période prolongée. Le disque peut rester coincé dans l'appareil ou l’endommager. Pour déplacer l'appareil, retirez tous les disques et fermez le plateau à disque. Puis appuyez sur la touche 8 STANDBY/ ON de l'appareil principal, attendez 10 secondes après la disparition de [OFF] de l'afficheur, et débranchez le cordon d'alimentation. Déplacer l'appareil alors qu'un disque se trouve à l'intérieur peut causer des dommages. ■ Condensation Des gouttes d’eau peuvent se former à l’intérieur de l’appareil si celui-ci est transporté depuis un endroit froid vers une pièce chaude, ou lorsqu’une pièce froide est rapidement chauffée. Ce phénomène est appelé condensation. Il peut provoquer un dysfonctionnement de l’appareil, mais également endommager le disque ou certaines parties de l’appareil. Nous vous conseillons de retirer les disques de l’appareil lorsque celui-ci ne doit pas être utilisé pendant une période prolongée. S’il est possible que de la condensation se soit formée, débranchez le cordon d'alimentation et laissez l’appareil au repos pendant au moins 3 heures à température ambiante. > Avant de Démarrer > Nom des pièces > Installation > Lecture Configuration avancée | Autres Caractéristiques générales ■ Sortie audio analogique ■ Autre Niveau de sortie et impédance nominale • RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100  Entrée Contrôle • Mini prise Ø3,5 (mono) Réponse en fréquence • CD: 2 Hz - 20 kHz, SACD : 2 Hz - 50 kHz (-3 dB) Sortie Contrôle • Mini prise Ø3,5 (mono) Rapport signal-bruit • CD: 116 dB ou plus (pondération A), SACD : 116 dB ou plus (pondération A) ■ Général THD+N • CD: 0,002 % ou moins, SACD: 0,002 % ou moins Consommation d'énergie • 43 W • 0,3 W (en Veille) ■ Entrée audio numérique AUTO STANDBY • ON (20 min) / OFF USB DAC • Type B, USB Audio Classe 1.0 Dimensions (L  H  P) • 435 mm  138 mm  413 mm ■ Sortie audio numérique Poids • 13,1 kg Alimentation • CA 220 - 230 V, 50/60 Hz Sortie numérique coaxiale • Prise RCA, 0,5 Vp-p / 75  Sortie optonumérique • Prise optique, -14 - -21 dBm / 660 nm Fr 19 20 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros SUPER AUDIO CD PLAYER PD-50AE Manual de instrucciones En Fr Es It De Nl Sv Antes de empezar Información de seguridad ....................................................... 2 Qué se encuentra en la caja ................................................... 3 Nombres de las piezas Panel frontal ........................................................................... 4 Panel trasero .......................................................................... 5 Mando a distancia .................................................................. 6 Pantalla ................................................................................... 7 Instalación Conexiones con un amplificador ............................................ 8 Conexión del cable de alimentación, etc. ..............................11 Reproducción Reproducción de discos ....................................................... 12 Usar esta unidad como convertidor D/A ............................... 14 Ajuste de la calidad de sonido .............................................. 15 Configuración avanzada Configuración avanzada........................................................ 16 Otros Resolución de problemas ..................................................... 17 Otras notas ............................................................................ 18 Especificaciones generales ................................................... 19 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Información de seguridad Antes de empezar WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR (OVtPERORGHUD\RFRQFDEH]DGHÀHFKDLQVFULWRHQXQ WULiQJXORHTXLOiWHURWLHQHOD¿QDOLGDGGHDYLVDUDOXVXDULROD SUHVHQFLDGH³WHQVLRQHVSHOLJURVDV´QRDLVODGDVGHQWURGHOD FDMDGHOSURGXFWTXHVRQGHPDJQLWXGVX¿FLHQWHFRPRSDUD FRQVWLWXLUXQULHVJRGHGHVFDUJDVHOpFWULFDVDSHUVRQDV (OVLJQRGHH[FODPDFLyQLQVFULWRHQXQWULiQJXORHTXLOiWHUR WLHQHOD¿QDOLGDGGHDYLVDUDOXVXDULRODSUHVHQFLDGH LQVWUXFFLRQHVLPSRUWDQWHVGHRSHUDWLyQ\PDQWHQLPLHQWR UHSDUDFLyQ HQODOLWHUDWXUDTXHDFRPSDxDDHVWHSURGXFWR 35(&$8&,Ï1 3$5$35(9(1,5(/3(/,*52'(&+248((/e&75,&212 5(029(5/$7$3$1,/$63$57(6'(17521287,/,=$'$6 //$0$581$3(5621$&8$/,),&$'$ $'9(57(1&,$ 3$5$35(9(1,5(/3(/,*52'(&+248((/e&75,&212 5(029(5/$7$3$1,/$63$57(6'(17521287,/,=$'$6 //$0$581$3(5621$&8$/,),&$'$ (VWHDSDUDWRQRHVLPSHUPHDEOH3DUDHYLWDUHOULHVJRGHLQFHQGLR\ GHGHVFDUJDVHOpFWULFDVQRSRQJDQLQJ~QUHFLSLHQWHOOHQRGHOtTXLGR FRPRSXHGDVHUXQYDVRRXQÀRUHUR FHUFDGHODSDUDWRQLORH[SRQJD DJRWHRVDOSLFDGXUDVOOXYLDRKXPHGDG 3DUDHYLWDUHOSHOLJURGHLQFHQGLRQRSRQJDQDGDFRQIXHJRHQFHQGLGR FRPRSXHGDVHUXQDYHOD HQFLPDGHODSDUDWR 1RXWLOLFHQLJXDUGHSLODVH[SXHVWDVGLUHFWDPHQWHDODOX]GHOVRORHQ XELFDFLRQHVFRQGHPDVLDGRFDORUFRPRHOLQWHULRUGHXQFRFKHRFHUFD GHXQFDOHQWDGRU(VWRSRGUtDSURYRFDUTXHODVSLODVWXYLHUDQSpUGLGDV VHVREUHFDOHQWDUDQH[SORWDUDQRVHSUHQGLHUDQ7DPELpQSXHGHUHGXFLU ODYLGDRUHQGLPLHQWRGHODVPLVPDV *XDUGHODVSLH]DVSHTXHxDVIXHUDGHODOFDQFHGHORVQLxRV6LODV LQJLULHUDQDFFLGHQWDOPHQWHSyQJDVHGHLQPHGLDWRHQFRQWDFWRFRQXQ PpGLFR /DVUDQXUDV\DEHUWXUDVGHODFDMDGHODSDUDWRVLUYHQSDUDVXYHQWLODFLyQ SDUDSRGHUDVHJXUDUXQIXQFLRQDPLHQWR¿DEOHGHODSDUDWR\SDUD SURWHJHUORFRQWUDVREUHFDOHQWDPLHQWR3DUDHYLWDUHOSHOLJURGHLQFHQGLR ODVDEHUWXUDVQXQFDGHEHUiQWDSDUVHQLFXEULUVHFRQQDGD FRPRSRU HMHPSORSHULyGLFRVPDQWHOHVFRUWLQDV QLSRQHUVHHQIXQFLRQDPLHQWR HODSDUDWRVREUHXQDDOIRPEUDJUXHVDVRXQDFDPD 5LHVJRGHH[SORVLyQVLODEDWHUtDVHFDPELDSRURWUDGHXQWLSR LQFRUUHFWR5LHVJRGHH[SORVLyQVLVHWLUDODEDWHUtDDOIXHJRRVHFRORFD HQXQKRUQRFDOLHQWHRVLVHPDFKDFDRFRUWDPHFiQLFDPHQWH 2 3UHFDXFLRQHV 6LLQVWDODHODSDUDWRHQXQDLQVWDODFLyQHPSRWUDGDFRPRHQXQD HVWDQWHUtDRHQXQDOLEUHUtDDVHJ~UHVHGHTXHHVWpELHQYHQWLODGR 'HMHFPGHHVSDFLROLEUHSRUHQFLPD\SRUORVODGRV\FPHQOD SDUWHSRVWHULRU(OERUGHSRVWHULRUGHOHVWDQWHRHOWDEOHURGHHQFLPDGHO DSDUDWRGHEHUtDHVWDUDXQRVFPGHOSDQHOSRVWHULRURGHODSDUHGGH IRUPDTXHGHMHXQHVSDFLROLEUHSDUDTXHHODLUHFDOLHQWHSXHGDFLUFXODU (QWRUQRGHIXQFLRQDPLHQWR 7HPSHUDWXUD\KXPHGDGGHOHQWRUQRGHIXQFLRQDPLHQWR&D& )D) PHQRVGHOGHKXPHGDGUHODWLYD UHMLOODVGH UHIULJHUDFLyQQRREVWUXLGDV 1RLQVWDOHHVWHDSDUDWRHQXQOXJDUPDOYHQWLODGRQLHQOXJDUHVH[SXHVWRV DDOWDKXPHGDGRDODOX]GLUHFWDGHOVRO RGHRWUDOX]DUWL¿FLDOSRWHQWH $YLVRLPSRUWDQWH (OQ~PHURGHPRGHOR\VHULHGHHVWHHTXLSRVHLQGLFDQHQVXSDUWH SRVWHULRURLQIHULRU$SXQWHHVWRVQ~PHURVHQODWDUMHWDGHJDUDQWtD DGMXQWD\JXiUGHODHQXQOXJDUVHJXURSDUDIXWXUDVFRQVXOWDV 35(&$8&,Ï1 (OLQWHUUXSWRUGHDOLPHQWDFLyQGHODXQLGDGQRGHVFRQHFWD FRPSOHWDPHQWHODDOLPHQWDFLyQSURFHGHQWHGHODWRPDGHFRUULHQWH&$ 3XHVWRTXHHOFDEOHGHDOLPHQWDFLyQKDFHODVIXQFLRQHVGHGLVSRVLWLYR GHGHVFRQH[LyQGHODFRUULHQWHSDUDHODSDUDWRSDUDGHVFRQHFWDUWRGD ODDOLPHQWDFLyQGHODSDUDWRGHEHUiGHVHQFKXIDUHOFDEOHGHODWRPD GHFRUULHQWHGH&$3RUORWDQWRDVHJ~UHVHGHLQVWDODUHODSDUDWRGH PRGRTXHHOFDEOHGHDOLPHQWDFLyQSXHGDGHVHQFKXIDUVHFRQIDFLOLGDG GHODWRPDGHFRUULHQWHGH&$HQFDVRGHXQDFFLGHQWH3DUDHYLWDU FRUUHUHOSHOLJURGHLQFHQGLRHOFDEOHGHDOLPHQWDFLyQWDPELpQGHEHUi GHVHQFKXIDUVHGHODWRPDGHFRUULHQWHGH&$FXDQGRQRVHWHQJDOD LQWHQFLyQGHXWLOL]DUORGXUDQWHPXFKRWLHPSRVHJXLGR SRUHMHPSOR DQWHVGHLUVHGHYDFDFLRQHV (VWHSURGXFWRHVSDUDWDUHDVGRPpVWLFDVJHQHUDOHV&XDOTXLHUDDYHUtD GHELGDDRWUDXWLOL]DFLyQTXHWDUHDVGRPpVWLFDV WDOHVFRPRHOXVRD ODUJRSOD]RSDUDPRWLYRVGHQHJRFLRVHQXQUHVWDXUDQWHRHOXVRHQ XQFRFKHRXQEDUFR \TXHQHFHVLWDXQDUHSDUDFLyQKDUiTXHFREUDUOD LQFOXVRGXUDQWHHOSHUtRGRGHJDUDQWtD 3UHFDXFLyQHQUHODFLyQFRQHOFDEOHHOpFWULFR 0DQLSXOHHOFDEOHHOpFWULFRSRUHOFRQHFWRU1RGHVFRQHFWHHOFRQHFWRU WLUDQGRGHOFDEOH\QRWRTXHQXQFDHOFDEOHGHDOLPHQWDFLyQFRQODV PDQRVPRMDGDV\DTXHHVWRSRGUtDSURYRFDUXQFRUWRFLUFXLWRRHO ULHVJRGHHOHFWURFXFLyQ1RFRORTXHODXQLGDGPXHEOHVHWFVREUHHO FDEOHGHDOLPHQWDFLyQ\HYLWHTXHVHSHOOL]TXH1RKDJDQXQFDQXGRV HQHOFDEOHQLORDWHDRWURVFDEOHV(OUHFRUULGRGHORVFDEOHVHOpFWULFRV GHEHHYLWDUODSRVLELOLGDGGHTXHVHSLVHQ8QFDEOHGHDOLPHQWDFLyQ GHWHULRUDGRSXHGHSURYRFDUXQLQFHQGLRRHOULHVJRGHHOHFWURFXFLyQ &RPSUXHEHHOHVWDGRGHOFDEOHGHDOLPHQWDFLyQGHYH]HQFXDQGR 6LYHTXHHVWiGHWHULRUDGRVROLFLWHDVXGLVWULEXLGRURDOFHQWURGH UHSDUDFLyQDXWRUL]DGRPiVFHUFDQRTXHORFDPELH 35(&$8&,Ï1 (VWHDSDUDWRHVXQSURGXFWRGHOiVHUGHFODVHFODVL¿FDGRFRPRWDOHQ 6HJXULGDGGHSURGXFWRVGHOiVHU,(& PRODUCTO LASER CLASE 1 ,QIRUPDFLyQSDUDORVXVXDULRVHQODUHFRJLGD\ WUDWDPLHQWRGHORVHTXLSRVDO¿QDOGHVXYLGD\GH ODVSLODV\EDWHUtDVXVDGDV Símbolo para equipos Símbolo para pilas y baterías Pb (VWRVVtPERORVHQORVSURGXFWRVHPEDODMH\RHQORVGRFXPHQWRV TXHORVDFRPSDxDQVLJQL¿FDTXHORVSURGXFWRVHOpFWULFRV\ HOHFWUyQLFRVDO¿QDOGHVXYLGDODVSLODV\EDWHUtDVQRGHEHQ PH]FODUVHFRQORVUHVLGXRVJHQHUDOHVGHVXKRJDU 3DUDHOWUDWDPLHQWRDGHFXDGRUHFXSHUDFLyQ\UHFLFODGRGHORV SURGXFWRVYLHMRV\ODVSLODVXVDGDVSRUIDYRUGHSRVtWHORVHQORV SXQWRVGHUHFRJLGDGHDFXHUGRFRQVXOHJLVODFLyQQDFLRQDO 0HGLDQWHHOWUDWDPLHQWRFRUUHFWDPHQWHGHHVWRVSURGXFWRV\ SLODVD\XGDUiDSUHVHUYDUORVUHFXUVRV\SUHYHQLUFXDOTXLHUHIHFWR QHJDWLYRHQODVDOXGKXPDQD\HOPHGLRDPELHQWHTXHSRGUtD VXUJLUSRUXQDLQDGHFXDGDPDQLSXODFLyQGHORVGHVSHUGLFLRV 3DUDPiVLQIRUPDFLyQVREUHUHFRJLGD\UHFLFODGRGHORVSURGXFWRV YLHMRVSLODV\EDWHUtDVSRUIDYRUFRQWDFWHFRQVXPXQLFLSLRVREUH ORFDOL]DFLyQGHORVSXQWRVOLPSLRVRGLUtMDVHDOSXQWRGHYHQWD GRQGHFRPSUyORVSURGXFWRV (VWRVVtPERORVVyORVRQYiOLGRVHQOD8QLyQ(XURSHD 3DUDSDtVHVIXHUDGHOD8QLyQHXURSHD 6LGHVHDHOLPLQDUHVWRVDUWtFXORVSRUIDYRUFRQWDFWDUFRQODV DXWRULGDGHVORFDOHVRHOGLVWULEXLGRU\SLGDSRUHOPpWRGRFRUUHFWR GHWUDWDPLHQWR :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Qué se encuentra en la caja 1. 2. 3. 4. • 1 2 3 Unidad principal (1) Mando a distancia (RC-980C) (1), Pilas (AAA/R03) (2) Cable de audio analógico (Para funcionamiento de prueba) (1) Cable de alimentación (1) Manual de instrucciones (este documento) (1) • El cable de alimentación no debe conectarse hasta que no se hayan completado todas las otras conexiones. • No aceptamos ninguna responsabilidad por daño causado debido a la conexión de equipos fabricados por otras compañías. • Las especificaciones y las características están sujetas a cambios sin previo aviso. La alimentación principal no se puede conectar o desconectar a través del mando a distancia. Utilice el botón 8 STANDBY/ON de la unidad principal. 4 Es 3 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Panel frontal Nombres de las piezas 1 6 2 3 7 8 9 1. Botón/indicador 8 STANDBY/ON: Enciende y apaga la alimentación principal de la unidad. Cuando se encienda la unidad, el indicador del centro del botón se iluminará en azul. 2. Indicador STANDBY: Se ilumina en rojo cuando la unidad está en modo de espera. 3. Bandeja del disco: Colocar aquí los discos. También pueden utilizarse discos de 8 cm. 4. Botón ; : Abrir o cerrar la bandeja de discos. 5. Botones de reproducción: u t : Volver a inicio de la pista que se está reproduciendo. Pulse de nuevo para pasar a la pista anterior. Manténgalo pulsado para rebobinar la pista rápidamente. q/h : Reproducir o pausar la reproducción. y i : Cuando se pulsa durante la reproducción, pasa a la siguiente pista. Manténgalo pulsado para avanzar rápido a través de la pista. g : Este botón detiene la reproducción. 4 4 5 bk bl 6. Sensor del mando a distancia • El rango de recepción del mando a distancia está a una distancia aproximada de 16´/5 m y a un ángulo de 20° en dirección vertical y 30° de derecha a izquierda. 7. Botón/indicador CD/SACD: Cambia entre CD/SACD como fuente. Cuando reproduzca un SACD híbrido, la capa que se está reproduciendo cambia si lo pulsa durante la reproducción. (P18) El indicador se ilumina en azul cuando se selecciona SACD. 8. Botón/indicador DIRECT: Activa y desactiva el modo DIRECT. (P15) El indicador se ilumina en azul cuando el modo DIRECT está en ON. 9. Pantalla (P7) 10.Botón SOURCE: Cambia la fuente a reproducir. 11. Botón SETUP: Muestra el menú SETUP. (P16) > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Panel trasero 1 2 3 4 5 1. Conector ANALOG OUT: Utilice un cable de audio analógico para conectar un amplificador integrado, por ejemplo. 2. AC IN: Conecte el cable de alimentación suministrado. 3. Puerto USB DAC: Utilice un cable USB (tipo A-B) para conectar un ordenador. 4. Conector DIGITAL OUT OPTICAL/COAXIAL: Utilice un cable óptico digital o un cable coaxial digital para conectar un amplificador integrado, por ejemplo. 5. Conector CONTROL IN/OUT: Si conecta amplificadores y dispositivos de audio de la marca Pioneer, puede centralizar el control. Por ejemplo, puede controlar los amplificadores y los dispositivos de audio. Es 5 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Mando a distancia 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. Botón ^ STANDBY/ON: Cuando la alimentación principal de la unidad está encendida, este botón enciende la unidad o la pone en modo de espera. La alimentación principal no se puede conectar o desconectar a través del mando a distancia. 2. Botón SHUFFLE: Ajuste la reproducción aleatoria. (P13) 3. Botón REPEAT: Ajuste la reproducción repetida. (P13) 4. Botones numerados: Utilícelos para introducir directamente el número de pista de un CD de música cuando se seleccionan pistas. También se utilizan para introducir números de pista para la reproducción de programa. 5. Botón CLEAR: Borra el contenido establecido para la reproducción de programa. (P13) 6. Botón DIGITAL FILTER: Seleccione uno de los tres tipos de DIGITAL FILTER. (P15) 7. Cursores, botón ENTER: Seleccione el elemento con los cursores y pulse ENTER para confirmar. 8. Botón SETUP: Muestra el menú SETUP. (P16) 9. Botones de reproducción: u : Volver a inicio de la pista que se está reproduciendo. Pulse de nuevo para pasar a la pista anterior. /h : Reproducir o pausar la reproducción. i : Pasar a la siguiente pista. t : Manténgalo pulsado para rebobinar rápidamente la pista que se está reproduciendo. g : Detener la reproducción. y : Manténgalo pulsado para hacer avanzar rápidamente la pista que se está reproduciendo. 10.Botón SOURCE: Cambia la fuente a reproducir. 11. Botón DIRECT: Activa y desactiva el modo DIRECT. (P15) 12.Botón DISPLAY: Cambia la información en la pantalla. • Dependiendo de la fuente, puede que la operación no se inicie. 13.Botón ; OPEN/CLOSE: Abrir o cerrar la bandeja de discos. 14.Botón PROGRAM: Se utiliza para la reproducción programada. (P13) 15.Botón LOCK RANGE: Muestra la pantalla de configuración LOCK RANGE ADJUST. (P15) 16.Botón RETURN: Regresa la pantalla al estado anterior. 17.Botón UP SAMPLING: Cambie la función UP SAMPLING ON y OFF. (P15) 18.Botón CD/SACD: Cambia entre CD/SACD como fuente. Cuando reproduzca un SACD híbrido, la capa que se está reproduciendo cambia si lo pulsa durante la reproducción. (P18) 19.Botón DIGITAL OUT: Activa y desactiva la salida digital. (P16) 20.Botón DISPLAY OFF: Púlselo para apagar la pantalla de la unidad. Pulse de nuevo para encender la pantalla. 21.Botón DIMMER: Puede ajustar el brillo de la pantalla en tres pasos. (Valor predeterminado: Nivel 3) Haga coincidir la polaridad cuando inserte las pilas. > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Pantalla 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Se ilumina durante la reproducción de SACD y DSD. 2. Visualización de mensajes: Muestra información sobre las pistas y los menús. 3. Se ilumina cuando es posible realizar operaciones con los cursores del mando a distancia. 4. Muestra el estado de reproducción. 5. Se ilumina cuando el ajuste de salida de audio digital está activado. (P16) 6. Se ilumina cuando se muestran elementos como el tiempo restante de una pista o del disco o el tiempo total del disco. 7. Mostrar al reproducir un archivo o secuencia MQA. Para más información, consulte "Reproducir MQA". (P18) Es 7 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Conexiones con un amplificador Instalación Esta unidad 1 a 2 1 a 2 a Amplificador integrado, receptor de AV, etc. Reproduzca el audio de los discos reproducidos en esta unidad y de los dispositivos conectados a esta unidad a través de sistemas de altavoces conectados a los amplificadores integrados o receptores AV. Establezca la conexión para adecuar los conectores de entrada de su amplificador. 8 a Cable de audio analógico Conexión con un cable de audio analógico La señal se convierte en analógica en el convertidor D/A de la unidad y después se transmite a un amplificador integrado, por ejemplo. Conecte los conectores LINE IN de un amplificador integrado al conector ANALOG OUT (conector RCA) de la unidad. > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Conexión con un cable óptico digital Conexión con un cable coaxial digital La señal se convierte en analógica en el convertidor D/A del amplificador integrado, por ejemplo. Conecte el conector OPTICAL IN de un amplificador integrado al conector DIGITAL OUT OPTICAL de la unidad. • El audio de SACD y DSD o la entrada de USB DAC no se emite desde el conector DIGITAL OUT OPTICAL de esta unidad. La señal se convierte en analógica en el convertidor D/A del amplificador integrado, por ejemplo. Conecte el conector COAXIAL IN de un amplificador integrado al conector DIGITAL OUT COAXIAL de la unidad. • El audio de SACD y DSD o la entrada desde USB DAC no se emite desde el conector DIGITAL OUT COAXIAL de esta unidad. • Las señales digitales que esta unidad puede transmitir son señales PCM lineales con una frecuencia de muestreo y una tasa de bits de cuantificación de 192 kHz/24 bit (puede que no sea posible el funcionamiento con todos los dispositivos conectados o entornos). • Las señales digitales que esta unidad puede transmitir son señales PCM lineales con una frecuencia de muestreo y una tasa de bits de cuantificación de 192 kHz/24 bit (puede que no sea posible el funcionamiento con todos los dispositivos conectados o entornos). Es 9 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros El conector de control Si posee múltiples dispositivos de la marca Pioneer, y estos tienen conectores CONTROL IN/OUT, puede controlarlos de manera centralizada a través del sensor del mando a distancia del amplificador, por ejemplo. Si se conectan cables mini plug monoaurales (sin resistencias) como se muestra en el diagrama, entonces incluso aunque esta unidad y otros dispositivos estén colocados en ubicaciones en las que no puedan recibir la señal del mando a distancia, aún puede utilizar el mando a distancia para controlar esta unidad u otros dispositivos apuntando el mando a distancia al sensor del mando a distancia del amplificador, por ejemplo. • Asegúrese también de que establece la conexión con el cable de audio analógico. El control centralizado no puede funcionar correctamente únicamente con la conexión del conector de control. • El sensor del mando a distancia de esta unidad deja de funcionar si conecta un cable mini plug monoaural (sin resistencia) al conector CONTROL IN de esta unidad. • Los sensores del mando a distancia que se encuentran en otros dispositivos dejan de funcionar si conecta un cable mini plug monoaural (sin resistencia) al conector CONTROL OUT de esta unidad. • Si un reproductor de red y un amplificador de marca Pioneer se conectan a través del conector CONTROL IN/ OUT, puede realizar operaciones básicas en esta unidad, el reproductor de red y el amplificador mediante una aplicación de teléfono inteligente a través de una red. 10 (Un ejemplo de conexión) IN OUT CONTROL a Amplificador a Esta unidad IN OUT CONTROL Dispositivo de audio a Cables mini plug monoaurales (sin resistencias) > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Conexión del cable de alimentación, etc. 1 Conexión del cable de alimentación 2 a a Este modelo incluye un cable de alimentación extraíble. El cable de alimentación debe conectarse sólo después de que todas las otras conexiones se hayan completado. Conecte el cable de alimentación al terminal AC IN de la unidad en primer lugar y luego conéctelo a la toma. Desconecte siempre el cable de alimentación del lado de la toma de corriente primero cuando desconecte el cable de alimentación. Puesta en marcha Pulse 8 STANDBY/ON en la unidad principal. • Al encender, pulse hasta que el botón se quede pulsado. Cuando se encienda la unidad, el indicador 8 STANDBY/ON del centro del botón se iluminará en azul. a Cable de alimentación Es 11 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Reproducción de discos Reproducción 1 Consulte (P18) para información sobre los discos que puede reproducir en esta unidad. Reproducción de CDs de música Realice el siguiente procedimiento cuando la unidad esté encendida. 1. Pulse CD/SACD en el mando a distancia para establecer la fuente en CD/SACD. 2. Pulse ; en la unidad principal para abrir la bandeja del disco, después de poner el disco en la bandeja, pulse de nuevo ; para cerrar la bandeja. 3. Pulse /h (g) en el mando a distancia para iniciar la reproducción. 4. Utilice los botones de reproducción (h) para detener la reproducción o elegir las pistas que desea reproducir. También puede seleccionar introduciendo el número de pista con los botones numéricos (b). Cuando introduzca un número de pista de 2 dígitos, pulse el botón +10 tantas veces como el valor del segundo dígito (decenas), después pulse el valor del primer dígito. Si pulsa DISPLAY (d), puede cambiar la pantalla para que muestre el tiempo transcurrido o el tiempo restante del disco, etc. • El contenido mostrado depende del disco. • La visualización del nombre de pista es compatible solo con archivos de música en formato MP3/WMA/ FLAC/AAC (M4A solo)/DSD (DSF solo). • Los caracteres que no se puedan mostrar en esta unidad aparecerán como "". a e b c f Reproducción de un disco con archivos de música 2 12 Realice el siguiente procedimiento cuando la unidad esté encendida. 1. Pulse CD/SACD en el mando a distancia para establecer la fuente en CD/SACD. 2. Pulse ; en la unidad principal para abrir la bandeja del disco, después de poner el disco en la bandeja, pulse de nuevo ; para cerrar la bandeja. 3. Pulse /h (g) en el mando a distancia para iniciar la reproducción. 4. Utilice los botones de reproducción (h) para detener la reproducción o elegir las pistas que desea reproducir. Si pulsa DISPLAY (d), puede cambiar la visualización para que muestre el tiempo transcurrido o el tiempo restante del disco, el nombre de archivo de la pista o el nombre de la pista, etc. • El contenido mostrado depende del disco y el archivo. g h d > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Reproducción repetida Especificaciones de los archivos que pueden reproducirse 1. Pulse repetidamente REPEAT (a) durante la reproducción para visualizar ALL o 1 en la pantalla. ALL : Reproducción repetida de todas las pistas. 1 : Reproducción repetida de la pista que se está reproduciendo. Para cancelar repetir reproducción, pulse REPEAT (a) varias veces hasta visualizar OFF en la pantalla. MP3 44,1/48 kHz WMA 44,1/48 kHz Reproducción aleatoria AAC 44,1/48/88,2/96 kHz 1. Pulse SHUFFLE (f) durante la reproducción o detención para mostrar en la pantalla. : Reproducción de todas las pistas aleatoriamente. Para cancelar la reproducción aleatoria, pulse SHUFFLE (f) hasta visualizar OFF en la pantalla. Reproducción de programa Puede seleccionar el orden en que se reproducen las pistas de un CD de música. 1. Pulse PROGRAM (e) mientras está detenido. "P00" se muestra cuando no se ha registrado nada. Introduzca el número de pista que quiere registrar con los botones numéricos (b). Cuando introduzca un número de pista de 2 dígitos, pulse el botón +10 tantas veces como el valor del segundo dígito (decenas), después pulse el valor del primer dígito. El número en "P00" aumenta cada vez que registra una pista. Se pueden registrar hasta 24 pistas. • Para reproducir el programa registrado, pulse /h (g) en el mando a distancia. • Si pulsa CLEAR (c) mientras se registran pistas, las pistas se borran en orden, empezando por la última que registró. • Si pulsa PROGRAM (e) mientras se registran pistas, todas las pistas que haya registrado se borrarán. • Si el tiempo de reproducción total del programa registrado excede de 99 minutos y 59 segundos, " : " se visualiza en la pantalla. Velocidades de muestreo WAV AIFF FLAC ALAC 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz Velocidades de bits Entre 8 kbps y 320 kbps y VBR. Entre 5 kbps y 192 kbps y VBR. Entre 8 kbps y 320 kbps y VBR. Bit de cuantificación Tipos de discos que pueden reproducirse Extensión CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW – .mp3 – .wma – * .aac/ .m4a – 8/16/24 bit * .wav – 8/16/24 bit * .aif/ .aiff – 8/16/24 bit * .flac – 8/16/24 bit * .m4a .dsf/ .dff 44,1/48/88,2/96/176,4/ .flac/ * MQA – 8/16/24 bit 192/352,8/384 kHz .wav * Cuando se reproduzcan archivos que excedan los 48 kHz, utilice archivos que hayan sido grabados en un disco DVD. Notas acerca de todos los tipos de archivos • Utilice discos CD/CD-R/CD-RW que cumplan con el estándar de sistema de archivos de CD-ROM nivel 1/nivel 2 ISO9660 y que estén grabados usando el sistema que cumpla con el formateo extendido (Joliet y Romeo). Cuando se usan discos DVD, además de lo mencionado anteriormente, utilice discos grabados usando el sistema de archivos UDF. • La estructura de carpetas está limitada a ocho niveles y el número máximo de pistas es 3000. Sin embargo, dependiendo de la estructura de carpetas, puede que no se reconozcan y reproduzcan todas las carpetas y pistas. DSD 2,8/5,6 MHz – 1 bit – Notas acerca de tipos específicos de archivos • Codifique los archivos WMA utilizando aplicaciones certificadas por Microsoft Corportation de los Estados Unidos. Puede que el funcionamiento no sea correcto si utiliza aplicaciones no certificadas. • Esta unidad es compatible con la reproducción de archivos AAC con la extensión ".m4a" que hayan sido codificados usando iTunes. Sin embargo, la reproducción no será posible si el archivo ha sido protegido con protección de copia DRM (protección de copyright) o con algunas versiones de iTunes utilizadas para la codificación. • Los archivos WAV incluyen audio digital PCM sin comprimir. • Los archivos AIFF incluyen audio digital PCM sin comprimir. Es 13 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Usar esta unidad como convertidor D/A Se puede convertir el audio digital del PC a analógico en esta unidad y, a continuación, emitirlo desde los conectores ANALOG OUT. 1 Cambiar de fuente 1. Pulse SOURCE en esta unidad o en el mando a distancia para cambiar la fuente de esta unidad a "USB DAC". USB DAC 2 Conexiones 2. Utilice un cable USB de tipo A-B para conectar un ordenador. Reproducción a 14 a Cable USB 3. Inicie la reproducción en el reproductor. • Las señales digitales que esta unidad puede introducir son señales PCM lineales con una frecuencia de muestreo y una tasa de bits de cuantificación de 48 kHz/ 32 bit (puede que no sea posible el funcionamiento con todos los dispositivos conectados o entornos). • SO compatibles del PC a conectar con Windows10® y Mac OS X. • Si se trata de otros SO diferentes a los compatibles, el sonido puede interrrumpirse o no emitirse. • Dependiendo del entorno de uso, la reproducción puede no realizarse normalmente > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Ajuste de la calidad de sonido Reproducción fiel del sonido original (modo DIRECT) El procesamiento que afecta a la calidad del sonido se desactivará para reproducir un sonido más cercano al original. (Valor predeterminado): OFF 1. Pulse DIRECT (d). • El indicador DIRECT de la parte delantera de la unidad principal se ilumina cuando el modo DIRECT está en ON. • Cuando el modo DIRECT está en ON, DIGITAL OUT se cambia a OFF. • En modo DIRECT, la pantalla se apaga automáticamente al reproducir un CD o SACD o conectar un USB DAC. • Al cambiar de configuración durante la reproducción, el audio puede interrumpirse. DIGITAL FILTER Seleccione uno de los tres tipos de DIGITAL FILTER. 1. La configuración cambia cada vez que pulsa DIGITAL FILTER (a). "SLOW": Sonido suave y fluido "SHARP" (Valor predeterminado): Sonido con mayor estructura y firmeza "SHORT": Sonido que comienza rápido y parece que se mueva hacia adelante • También puede pulsar SETUP (c) para visualizar la pantalla de configuración DIGITAL FILTER desde el menú SETUP. En ese caso, seleccione el valor de ajuste con / (b) en el mando a distancia. • La configuración se establece en "SHORT" al reproducir MQA-CD o un disco que contenga archivos de música o utilizando USB DAC. • Al cambiar de configuración durante la reproducción, el audio puede interrumpirse. UP SAMPLING Aumentar la frecuencia de muestreo ayuda a conseguir una reproducción de sonido con un grado de claridad más alto. (Valor predeterminado) : OFF 1. También se puede pulsar UP SAMPLING (g) para ON y OFF la función. • Esta función no se puede utilizar cuando el modo DIRECT está configurado en ON o durante la reproducción de SACD o DSD. • La configuración se establece en "ON" al reproducir MQA-CD o un disco que contenga archivos de música o utilizando USB DAC. • Al cambiar de configuración durante la reproducción, el audio puede interrumpirse. Ajuste del rango de bloqueo (LOCK RANGE ADJUST) La calidad de sonido se mejora reduciendo el rango de bloqueo para reducir los sonidos incidentales. Sin embargo, reducir el rango de bloqueo demasiado puede provocar interrupciones en el sonido y ruido. Ajuste el rango de bloqueo mientras escucha algún audio. (Valor predeterminado): RANGE 6 1. Pulse LOCK RANGE (e). 2. Seleccione el valor de ajuste con / (f) en el mando a distancia. "RANGE 6" (amplio) a "RANGE 1" (reducido) • También puede pulsar SETUP (c) para visualizar la pantalla de configuración LOCK RANGE ADJUST desde el menú SETUP. • La configuración se establece en "6" al reproducir MQA-CD o un disco que contenga archivos de música o utilizando USB DAC. • LOCK RANGE ADJUST no tiene efecto en el audio de SACD y DSD. • Al cambiar de configuración durante la reproducción, el audio puede interrumpirse. a e b f c d g Es 15 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Configuración avanzada Configuración avanzada 1 La unidad le permite configurar ajustes avanzados para brindarle una experiencia todavía mejor. 1. Pulse SETUP en el mando a distancia. AUTO STANDBY 2. Seleccione el contenido o el ajuste con los cursores del mando a distancia y pulse ENTER para confirmar su selección. Para volver a la pantalla anterior, pulse RETURN. AUTO STANDBY UP SAMPLING Este ajuste pone la unidad en modo de espera automáticamente después de 20 minutos de inactividad sin ningún tipo de entrada de audio. "ON" (Valor predeterminado): La unidad pasará automáticamente al modo de espera. "OFF": La unidad no pasará automáticamente al modo de espera. Aumentar la frecuencia de muestreo ayuda a conseguir una reproducción de sonido con un grado de claridad más alto. (P15) POWER ON PLAY LOADING MODE Puede ajustarlo de modo que el disco empiece a reproducirse automáticamente cuando se encienda la unidad. • Usando un temporizador automático conectado externamente, puede usar la reproducción con temporizador cuando se enciende automáticamente la alimentación. "ON": Para reproducir discos automáticamente "OFF" (Valor predeterminado): Cuando no se van a reproducir discos El tiempo de carga para CD se puede reducir. • Al activar esta función, el tiempo de carga se reduce dependiendo del CD. Sin embargo, se pueden producir saltos al principio de la reproducción. "NORMAL" (Valor predeterminado): El tiempo de carga para CD no se reduce "FAST": El tiempo de carga para CD se reduce DIGITAL OUT Realice los ajustes de la salida de audio digital. Cuando no se conecte al conector DIGITAL OUT OPTICAL/COAXIAL, puede escuchar un audio aún más claro ajustando esto en OFF. "ON" (Valor predeterminado), "OFF" DIGITAL FILTER Puede seleccionar el tipo de DIGITAL FILTER. (P15) 3. Para salir de los ajustes, pulse SETUP. 16 LOCK RANGE ADJUST Ajuste del rango de bloqueo. (P15) > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Resolución de problemas Otros Antes de iniciar el procedimiento Cuando el funcionamiento es inestable, se pueden resolver los problemas simplemente encendiendo la unidad o poniéndola en modo de espera o desconectando y volviendo a conectar el cable de alimentación, en vez de revisar los ajustes y operaciones. Intente las medidas simples tanto en la unidad como en el dispositivo conectado. Si el problema no se soluciona después de consultar "Resolución de problemas", el problema podría solucionarse restaurando la unidad al estado en el que se encontraba en el momento de envío. Restauración de la unidad (esto restaura la configuración predeterminada de fábrica) 1. Con la unidad encendida y ningún disco insertado, mientras mantiene pulsado g en la unidad principal, pulse DIRECT. 2. Se visualizará "CLEAR", la unidad pasará al modo de espera y los ajustes se reiniciarán. CLEAR ■ Alimentación No se puede conectar la unidad • Desconecte el cable de alimentación de la toma de corriente, espere 2 minutos o más y conéctelo nuevamente. La unidad se apaga inesperadamente • La unidad pasa automáticamente al modo de espera cuando funciona el ajuste "AUTO STANDBY" en el menú de configuración SETUP. El indicador STANDBY de la unidad principal continúa parpadeando en rojo y no es posible realizar operaciones. • Desconecte el cable de alimentación de la toma de corriente, espere 2 minutos o más y conéctelo nuevamente. El indicador continuará parpadeando, pero pulse 8 STANDBY/ON en la unidad principal para encender la alimentación principal ajustándola en ON. Si esto no resuelve el problema, puede que se haya producido un mal funcionamiento. Desconecte el cable de alimentación de la toma de corriente y póngase en contacto con el distribuidor o con nuestro servicio de soporte técnico. ■ La pantalla no se ilumina • Puede que la pantalla se haya apagado al pulsar DISPLAY OFF. Pulse DISPLAY OFF para encender la pantalla. ■ No se pueden reproducir discos • Coloque el disco en la bandeja de discos con el lado etiquetado hacia arriba. • Puede que la reproducción no sea posible si el disco está rayado o sucio. • Los archivos de sonido que están protegidos por las leyes de derechos de autor no se pueden reproducir. • La bandeja del disco se abre si inserta un disco que no sea compatible con esta unidad. ■ Audio El sonido se interrumpe • Reducir el rango de bloqueo demasiado con el ajuste LOCK RANGE ADJUST puede provocar interrupciones en el sonido y también puede causar ruido. Las interrupciones de sonido causadas por ajustes en el rango de bloqueo no están cubiertas por nuestras garantías de funcionamiento. Escuche algún audio mientras ajusta el rango de bloqueo. • Instale pilas nuevas. No mezcle distintos tipos de pilas, o pilas nuevas con usadas. • Asegúrese de que esta unidad no esté expuesta a la luz solar directa o a luces fluorescentes de tipo inversión. Reubique si es necesario. • Si esta unidad está instalada en un estante o una vitrina con puertas de cristal de color, o si las puertas están cerradas, el mando a distancia podría no funcionar con precisión. ■ Función de convertidor D/A • Asegúrese de que los dispositivos están conectados adecuadamente. • Reproduzca audio compatible con los conectores de entrada de esta unidad. (P14) No se puede reproducir audio desde ordenadores • Cancele el modo silencioso en su ordenador. • Seleccione esta unidad en los ajustes de salida de audio de su ordenador. Si la fuente de esta unidad se establece en algo que no sea “USB DAC”, el PC no puede detectar esta unidad. • Si se están ejecutando múltiples aplicaciones en el ordenador, apague las aplicaciones que no esté utilizando. La frecuencia de muestreo es siempre la misma a través de la entrada USB DAC • Dependiendo de los ajustes del ordenador, incluso aunque las frecuencias de muestreo de los archivos que se están reproduciendo sean diferentes, estas se convierten a la misma frecuencia de muestreo para su transmisión. No hay sonido digital • Establezca "DIGITAL OUT" en el menú SETUP en "ON". • El audio de SACD y DSD o entrada desde USB DAC no se emite digitalmente. Los sonidos del ordenador que no son música se escuchan a través de la entrada USB DAC • Dependiendo de los ajustes del ordenador, sonidos como el tono de inicio del ordenador o los sonidos de error puede que se reproduzcan a través de esta unidad. ■ Mando a distancia ■ SACD • Asegúrese de que las pilas están instaladas con la polaridad correcta. • Debido a las diferencias en los métodos de grabación, puede que exista una diferencia de volumen entre SACD y CD. Es 17 > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Otras notas ■ Discos que pueden reproducirse MQA-CD SACD (Super Audio CD) (solo área de 2 canales) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Precauciones para la reproducción • Pueden usarse los discos compactos (CDs) con el siguiente logo en la superficie de la etiqueta. Reproducción de SACD híbrido El SACD híbrido consiste en dos capas; la capa SACD y la capa CD. Pulse CD/SACD para seleccionar la capa que desee escuchar. Reproducción de DualDisks Un "DualDisk" es un disco con vídeo y audio que cumple el estándar DVD por una cara y contiene audio que puede reproducirse en un reproductor de CD en la otra. En la cara de audio que no es la cara de DVD, puede que la reproducción no sea siempre posible debido a que el disco no cumple con las especificaciones físicas de los CD estándar. Operaciones durante la reproducción La búsqueda directa no funciona mientras se reproducen discos con datos de música. • Tenga en cuenta que puede que algunos discos no se reproduzcan debido a las características del disco, a rayones, a la contaminación o al estado de grabación. Reproducir MQA Esta unidad incluye la tecnología MQA (Master Quality Authenticated) que permite la reproducción de archivos y transmisiones de audio MQA, ofreciendo el mismo sonido que la grabación maestra original. Esta unidad es un reproductor de CD que puede reconocer un MQA-CD. El descodificador integrado MQA restablecerá y confirmará la señal de alta resolución que se emite en el estudio con la firma de autenticación. Visite www.mqa.co.uk/customer/mqacd para obtener más información. ‘MQA’ o ‘MQA.’ indica que el producto está descodificando y reproduciendo una secuencia o archivo MQA e indica la procedencia para garantizar que el sonido es idéntico al material de la fuente. ‘MQA.’ indica que está reproduciendo un archivo MQA Studio, que ha sido autorizado en el estudio por el artista/productor o verificado por el propietario del copyright. 18 Tipos de discos que no pueden reproducirse en esta unidad DVD Video, DVD Audio, CD-G, Video CD, DTS-CD Notas sobre los discos • Tenga cuidado de no pillarse la mano o los dedos cuando abra o cierre la bandeja de discos. • Nunca use discos con formas inusuales (como corazones u octógonos). Este tipo de discos podría atascarse y dañar la unidad. • Algunos CDs de audio con control de copia no cumplen los estándares de CD oficiales. Se trata de discos especiales y no pueden reproducirse en esta unidad. • No use discos con residuos de celofán, discos alquilados con pegatinas que se despegan o discos con etiquetas decorativas. Estos tipos de discos podrían quedarse pegados a la unidad o podrían dañarla. • No deje en la unidad un disco con una etiqueta impresa con una impresora de inyección durante un tiempo prolongado. El disco podría quedarse pegado a la unidad o podría dañarla. ■ Limpieza del reproductor • Normalmente, limpie el reproductor con un paño blando. Para eliminar la suciedad difícil de quitar, ponga un poco de detergente neutro diluido en 5 ó 6 partes de agua en un paño blando, escurra bien el paño, páselo por el reproductor y, finalmente, pase un paño seco. • El uso de alcohol, diluyente, bencina o insecticida en el reproductor puede ser la causa de que la pintura y el revestimiento se despeguen. Evite también dejar productos de goma o vinilo en contacto con el reproductor durante mucho tiempo porque se dañará la caja. • Cuando use paños impregnados en productos químicos, etc., lea las instrucciones del paño cuidadosamente. • Cuando sea difícil eliminar el polvo adherido a la bandeja del disco, aplique una cinta adhesiva, etc. para eliminar el polvo. ■ Precauciones al mover la unidad Cuando mueva la unidad, retire cualquier disco y cierre la bandeja de discos. A continuación pulse 8 STANDBY/ON en la unidad principal, espere 10 segundos después de que [OFF] desaparezca de la pantalla y entonces desenchufe el cable de alimentación. Mover la unidad mientras aún hay un disco en ella puede provocar daños. ■ Condensación Pueden formarse gotas de agua en el interior de la unidad si se lleva de un lugar frío a una habitación cálida o cuando una habitación fría se calienta rápidamente con una calefacción. A esto se le llama condensación. Esto no solo puede provocar que la unidad funcione mal, sino que también puede dañar el disco o partes de la unidad. Se recomienda quitar los discos de la unidad si no se va a usar durante un tiempo. Si existe la posibilidad de que se haya formado condensación, desenchufe el cable de alimentación y permita que la unidad permanezca a temperatura ambiente durante al menos 3 horas. > Antes de empezar > Nombres de las piezas > Instalación > Reproducción Configuración avanzada | Otros Especificaciones generales ■ Salida de audio analógico ■ Otros Nivel de salida nominal e impedancia • RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100  Entrada de control • Miniconector Ø3,5 (mono) Respuesta de frecuencia • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Salida de control • Miniconector Ø3,5 (mono) Relación señal/ruido • CD: 116 dB o más (A-weighting), SACD: 116 dB o más (A-weighting) ■ General THD+N • CD: 0,002 % o menos, SACD: 0,002 % o menos ■ Entrada de audio digital USB DAC • Tipo B, USB Audio Class 1.0 ■ Salida de audio digital Salida digital coaxial • Conector RCA, 0,5 Vp-p / 75  Alimentación • 220 - 230 V CA, 50/60 Hz Consumo de energía • 43 W • 0,3 W (en modo de espera) AUTO STANDBY • ON (20 min) / OFF Dimensiones (An  Al  Pr) • 435 mm  138 mm  413 mm Peso • 13,1 kg Salida digital óptica • Conector óptico, -14 - -21 dBm / 660 nm Es 19 20 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri SUPER AUDIO CD PLAYER PD-50AE Manuale di istruzioni En Fr Es It De Nl Sv Prima di iniziare Informazioni relative alla sicurezza ......................................... 2 Contenuto della confezione .................................................... 3 Nome dei componenti Pannello frontale ..................................................................... 4 Pannello posteriore ................................................................. 5 Telecomando .......................................................................... 6 Display .................................................................................... 7 Installazione Collegamenti con un amplificatore ......................................... 8 Collegamento del cavo di alimentazione, ecc. ......................11 Riproduzione Riproduzione di dischi .......................................................... 12 Utilizzo di questa unità come convertitore D/A ..................... 14 Regolazione della qualità audio ............................................ 15 Impostazioni avanzate Impostazioni Avanzate .......................................................... 16 Altri Risoluzione dei problemi ...................................................... 17 Altre note ............................................................................... 18 Caratteristiche generali.......................................................... 19 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Informazioni relative alla sicurezza Prima di iniziare WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR ,OVLPERORGHOIXOPLQHUDFFKLXVRLQXQWULDQJRORHTXLODWHURVHUYHDG DYYLVDUHO¶XWLOL]]DWRUHGHOODSUHVHQ]DGL³WHQVLRQLSHULFRORVH´QRQLVRODWH DOO¶LQWHUQRGHOULYHVWLPHQWRGHOSURGRWWRFKHSRVVRQRHVVHUHGLLQWHQVLWj VXႈFLHQWHGDFRVWLWXLUHXQULVFKLRGLVFRVVHHOHWWULFKHDOOHSHUVRQH ,OSXQWRHVFODPDWLYRDOO¶LQWHUQRGLXQWULDQJRORHTXLODWHUR VHUYHDGDYYLVDUHO¶XWLOL]]DWRUHGHOODSUHVHQ]DGLLPSRUWDQWL LVWUX]LRQLSHUO¶LPSLHJRHODPDQXWHQ]LRQH ULSDUD]LRQH QHL PDQXDOLDOOHJDWLDOSURGRWWR $77(1=,21( 3(5(9,7$5(,/5,6&+,2',6&266((/(775,&+(1215,0829(5(,/ &23(5&+,2 2,/5(752 121&,62123$57,,17(51(/$&8,0$187(1=,21( 3266$(66(5(())(778$7$'$//¶87(17(,1&$62',1(&(66,7¬ 5,92/*(56,(6&/86,9$0(17($3(5621$/(',6(59,=,248$/,),&$72 $77(1=,21( 3(5(9,7$5(,/5,6&+,2',6&266((/(775,&+(121 5,0829(5(,/&23(5&+,2 2,/5(752 121&,6212 3$57,,17(51(/$&8,0$187(1=,21(3266$(66(5( ())(778$7$'$//¶87(17(,1&$62',1(&(66,7¬5,92/*(56, (6&/86,9$0(17($3(5621$/(',6(59,=,248$/,),&$72 4XHVWRDSSDUHFFKLRQRQqLPSHUPHDELOH3HUSUHYHQLUHSHULFROLGL LQFHQGLRIROJRUD]LRQLQRQSRVL]LRQDUHQHOOHYLFLQDQ]HGLTXHVWR DSSDUHFFKLRFRQWHQLWRULSLHQLGLOLTXLGL TXDOLYDVLGD¿RULRVLPLOL HQRQ HVSRUUHO¶DSSDUHFFKLRDVJRFFLROLLVFKL]]LSLRJJLDRXPLGLWj 3HUHYLWDUHLOSHULFRORGLLQFHQGLQRQSRVL]LRQDUHVXOO¶DSSDUHFFKLR GLVSRVLWLYLFRQ¿DPPHYLYH DGHVHPSLRXQDFDQGHODDFFHVDRVLPLOL 1RQXVDUHQpFRQVHUYDUHOHEDWWHULHDOODOXFHGLUHWWDGHOVROHRLQ OXRJKLHFFHVVLYDPHQWHFDOGLDGHVHPSLRDOO¶LQWHUQRGLXQ¶DXWRPRELOH RLQSURVVLPLWjGLXQFDORULIHUR/HEDWWHULHSRWUHEEHURSHUGHUHOLTXLGR VXUULVFDOGDUVLHVSORGHUHRSUHQGHUHIXRFR$QFKHODGXUDWDHOH SUHVWD]LRQLGHOOHEDWWHULHSRWUHEEHURULVXOWDUHULGRWWH &RQVHUYDUHLSLFFROLULFDPELIXRULGDOODSRUWDWDGHLEDPELQLHGHLEHEp 6HLQJKLRWWLWLDFFLGHQWDOPHQWHUHFDUVLLPPHGLDWHPHQWHGDOPHGLFR 2 /¶DSSDUHFFKLRqGRWDWRGLXQFHUWRQXPHURGLIHVVXUHHGLDSHUWXUHSHU ODYHQWLOD]LRQHDOORVFRSRGLJDUDQWLUQHXQIXQ]LRQDPHQWRDႈGDELOHH SHUSURWHJJHUORGDOVXUULVFDOGDPHQWR3HUSUHYHQLUHSRVVLELOLSHULFROLGL LQFHQGLOHDSHUWXUHQRQGHYRQRPDLYHQLUHEORFFDWHRFRSHUWHFRQRJJHWWL YDUL TXDOLJLRUQDOLWRYDJOLHWHQGHRWHQGDJJLHFF HO¶DSSDUHFFKLRQRQ GHYHHVVHUHXWLOL]]DWRDSSRJJLDQGRORVXWDSSHWLVSHVVLRVXOOHWWR 3HULFRORGLHVSORVLRQHVHODEDWWHULDYLHQHVRVWLWXLWDFRQXQDGLWLSRQRQ FRUUHWWR5LVFKLRGLHVSORVLRQHVHODEDWWHULDYLHQHVPDOWLWDLQ¿DPPHR IRUQLRVHYLHQHPHFFDQLFDPHQWHVFKLDFFLDWDRWDJOLDWD 3UHFDX]LRQL 6HVLLQVWDOODO¶DSSDUHFFKLRDOO¶LQWHUQRGLXQPRELOHFRPHDGHVHPSLR XQDOLEUHULDRXQRVFDႇDOHDVVLFXUDUVLFKHFLVLDXQ¶DGHJXDWD YHQWLOD]LRQH /DVFLDUHXQRVSD]LROLEHURGLFPVRSUDHDLODWLGHOO¶DSSDUHFFKLRH FPVXOUHWUR,OODWRSRVWHULRUHGHOORVFDႇDOHRLOULSLDQRVRSUD O¶DSSDUHFFKLRGHYRQRHVVHUHUHJRODWLDFPGLGLVWDQ]DGDOSDQQHOOR SRVWHULRUHRGDOPXURFUHDQGRXQ¶DSHUWXUDSHUODIXRULXVFLWDGHOO¶DULDFDOGD &RQGL]LRQLDPELHQWDOLGLIXQ]LRQDPHQWR *DPPDLGHDOHGHOODWHPSHUDWXUDHGXPLGLWjGHOO¶DPELHQWHGL IXQ]LRQDPHQWRGD&D& GD)D) XPLGLWjUHODWLYD LQIHULRUHDOOµ IHVVXUHGLYHQWLOD]LRQHQRQEORFFDWH 1RQLQVWDOODUHO¶DSSDUHFFKLRLQOXRJKLSRFRYHQWLODWLRLQOXRJKLHVSRVWL DGDOWHXPLGLWjRDOODGLUHWWDOXFHGHOVROH RDVRUJHQWLGLOXFHDUWL¿FLDOH PROWRIRUWL $YYLVRLPSRUWDQWH ,OQXPHURGHOPRGHOORHGLOQXPHURGLVHULHGLTXHVWDDSSDUHFFKLDWXUD VLWURYDQRVXOUHWURRVXOIRQGR$QQRWDUHTXHVWLQXPHULVXOODVFKHGDGL JDUDQ]LDDOOHJDWDHFRQVHUYDUHLQXQOXRJRVLFXURSHUULIHULPHQWRIXWXUR $99(57(1=$ ,OSXOVDQWHGLDFFHQVLRQHVXTXHVWDXQLWjQRQGLVWDFFDFRPSOHWDPHQWH ODFRUUHQWHSURYHQLHQWHGDOODSUHVD&$'DOPRPHQWRFKHLOFDYRGL DOLPHQWD]LRQHFRVWLWXLVFHO¶XQLFRGLVSRVLWLYRGLGLVWDFFRGHOO¶DSSDUHFFKLR GDOODVRUJHQWHGLDOLPHQWD]LRQHLOFDYRVWHVVRGHYHHVVHUHVWDFFDWR GDOODSUHVDGLFRUUHQWHDOWHUQDWDGLUHWHSHUVRVSHQGHUHFRPSOHWDPHQWH TXDOVLDVLÀXVVRGLFRUUHQWH9HUL¿FDUHTXLQGLFKHO¶DSSDUHFFKLRVLD VWDWRLQVWDOODWRLQPRGRGDSRWHUSURFHGHUHFRQIDFLOLWjDOGLVWDFFRGHO FDYRGLDOLPHQWD]LRQHGDOODSUHVDGLFRUUHQWHLQFDVRGLQHFHVVLWj 3HUSUHYHQLUHSHULFROLGLLQFHQGLLQROWUHLOFDYRGLDOLPHQWD]LRQHGHYH HVVHUHVWDFFDWRGDOODSUHVDGLFRUUHQWHDOWHUQDWDGLUHWHVHVLSHQVDGL QRQXWLOL]]DUHO¶DSSDUHFFKLRSHUSHULRGLGLWHPSRUHODWLYDPHQWHOXQJKL DG HVHPSLRGXUDQWHXQDYDFDQ]D 4XHVWRSURGRWWRqGHVWLQDWRHVFOXVLYDPHQWHDOO¶XVRGRPHVWLFR (YHQWXDOLGLVIXQ]LRQLGRYXWHDGXVLGLYHUVL TXDOLXVRSUROXQJDWRDVFRSL FRPPHUFLDOLLQULVWRUDQWLRXVRLQDXWRRVXQDYL HFKHULFKLHGDQR SDUWLFRODULULSDUD]LRQLVDUDQQRDFDULFRGHOO¶XWHQWHDQFKHVHQHOFRUVR GHOSHULRGRGLJDUDQ]LD $YYHUWHQ]DUHODWLYDDOFDYRHOHWWULFR $ႇHUUDUHLOFDYRGLDOLPHQWD]LRQHGDOODVSLQD1RQVWDFFDUHODVSLQD WLUDQGRLOFDYRHQRQWRFFDUHPDLLOFDYRHOHWWULFRFRQOHPDQLEDJQDWHLQ TXDQWRTXHVWRSRWUHEEHFDXVDUHXQFRUWRFLUFXLWRRXQDVFRVVDHOHWWULFD 1RQSRVL]LRQDUHO¶XQLWjXQPRELOHHFFVXOFDYRHOHWWULFRRSL]]LFDUH LOFDYR1RQIDUHPDLXQQRGRQHOFDYRROHJDUORFRQDOWULFDYL,FDYL HOHWWULFLGHYRQRHVVHUHLQVWUDGDWLLQPRGRWDOHFKHQRQVLDSRVVLELOH FDOSHVWDUOL8QFDYRHOHWWULFRGDQQHJJLDWRSXzFDXVDUHXQLQFHQGLR RXQDVFRVVDHOHWWULFD&RQWUROODUHSHULRGLFDPHQWHLOFDYRHOHWWULFR 4XDQGRVLULOHYDFKHqGDQQHJJLDWRULFKLHGHUQHXQRVRVWLWXWLYRDOQRVWUR FHQWURGLDVVLVWHQ]DDXWRUL]]DWRSLYLFLQRRDOSURSULRULYHQGLWRUH $99(57(1=$ 4XHVWRDSSDUHFFKLRqXQSURGRWWRDOODVHUGL&ODVVHVHFRQGROH QRUPHGLVLFXUH]]DGHLSURGRWWLDOODVHU,(& PRODOTTO LASER DI CLASSE 1 ,QIRUPD]LRQLSHUJOLXWLOL]]DWRUL¿QDOLVXOODUDFFROWD HORVPDOWLPHQWRGLYHFFKLGLVSRVLWLYLHEDWWHULH HVDXVWH Simbolo per il prodotto Esempi di simboli per le batterie Pb 4XHVWLVLPEROLVXLSURGRWWLFRQIH]LRQLHRGRFXPHQWLDOOHJDWL VLJQL¿FDQRFKHYHFFKLSURGRWWLHOHWWULFLHGHOHWWURQLFLHEDWWHULH HVDXVWHQRQGHYRQRHVVHUHPLVFKLDWLDLUL¿XWLXUEDQLLQGLႇHUHQ]LDWL 3HUO¶DSSURSULDWRWUDWWDPHQWRUHFXSHURHULFLFODJJLRGLYHFFKL SURGRWWLHEDWWHULHHVDXVWHIDWHULIHULPHQWRDLSXQWLGLUDFFROWD DXWRUL]]DWLLQFRQIRUPLWjDOODYRVWUDOHJLVOD]LRQHQD]LRQDOH &RQLOFRUUHWWRVPDOWLPHQWRGLTXHVWLSURGRWWLHGHOOHEDWWHULH DLXWHUDLDVDOYDJXDUGDUHSUH]LRVHULVRUVHHSUHYHQLUHLSRWHQ]LDOL HႇHWWLQHJDWLYLVXOO¶DPELHQWHHVXOODVDOXWHXPDQDFKHDOWULPHQWL SRWUHEEHURVRUJHUHGDXQDLQDSSURSULDWDJHVWLRQHGHLUL¿XWL 3HUPDJJLRULLQIRUPD]LRQLVXOODUDFFROWDHLOULFLFODJJLRGLYHFFKL SURGRWWLHEDWWHULHHVDXVWHFRQWDWWDWHLOYRVWUR&RPXQHLO6HUYL]LR GLUDFFROWDRLOSXQWRYHQGLWDGRYHDYHWHDFTXLVWDWRO¶DUWLFROR 4XHVWLVLPEROLVRQRYDOLGLVRORQHOO¶8QLRQH(XURSHD 3HULSDHVLDOGLIXRULGHOO¶XQLRQH(XURSHD 6HYROHWHOLEHUDUYLTXHVWLRJJHWWLFRQWDWWDWHOHYRVWUHDXWRULWjORFDOL RLOSXQWRYHQGLWDSHULOFRUUHWWRPHWRGRGLVPDOWLPHQWR :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Contenuto della confezione 1. 2. 3. 4. • 1 2 3 Unità principale (1) Telecomando (RC-980C) (1), Batterie (AAA/R03) (2) Cavo audio analogico (per operazioni di test) (1) Cavo di alimentazione (1) Manuale di istruzioni (questo documento) (1) • Il cavo di alimentazione deve essere collegato solo dopo che sono stati completati tutti gli altri collegamenti. • Non accetteremo responsabilità per danni derivanti dal collegamento di apparecchiature prodotte da altre aziende. • Le specifiche tecniche e l’aspetto sono soggetti a variazioni senza preavviso. Non è possibile accendere o spegnere l'unità con il telecomando. Usare il tasto 8 STANDBY/ON sull'unità principale. 4 It 3 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Pannello frontale Nome dei componenti 1 6 2 3 7 8 9 1. Pulsante/indicatore 8 STANDBY/ON: Consente di accendere/spegnere l'unità. All'avvio dell'unità, l'indicatore posto al centro del pulsante si accende in blu. 2. Indicatore STANDBY: È rosso fisso quanto l'unità è in modalità standby. 3. Piatto portadisco: Posizionare i dischi qui. Possono essere utilizzati anche dischi da 8 cm. 4. Pulsante ; : Apre o chiude il piatto portadisco. 5. Tasti di riproduzione: u t : Torna all'inizio del brano in riproduzione. Premere nuovamente per passare al brano precedente. Tenere premuto per riavvolgere il brano velocemente. q/h : Avvia o mette in pausa la riproduzione. y i : Quando viene premuto durante la riproduzione, passa al brano successivo. Tenere premuto per mandare avanti il brano velocemente. g : Questo tasto arresta la riproduzione. 6. Sensore del telecomando • Il campo di ricezione del telecomando è entro una distanza di circa 16'/5 m, con un angolo di 20° in direzione verticale e di 30° a destra e sinistra. 4 4 5 bk bl 7. Pulsante/indicatore CD/SACD: Consente di scegliere tra CD e SACD come sorgente. Premendo questo pulsante durante la riproduzione di un disco SACD ibrido, viene modificato il layer in riproduzione. (P18) L'indicatore si accende in blu quando viene selezionato SACD. 8. Pulsante/indicatore DIRECT: Consente di attivare e disattivare la modalità DIRECT. (P15) L'indicatore si accende in blu quando la modalità DIRECT è attiva. 9. Display (P7) 10.Pulsante SOURCE: Seleziona la sorgente da riprodurre. 11. Pulsante SETUP: Consente di visualizzare il menu SETUP. (P16) > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Pannello posteriore 1 2 3 4 5 1. Jack ANALOG OUT: Utilizza un cavo audio analogico per collegare, ad esempio, un amplificatore integrato. 2. AC IN: Consente di collegare il cavo di alimentazione in dotazione. 3. Porta USB DAC: Utilizzare un cavo USB (di tipo A-B) per collegare un computer. 4. Jack DIGITAL OUT OPTICAL/COAXIAL: Utilizzare un cavo digitale ottico o un cavo digitale coassiale per collegare, ad esempio, un amplificatore integrato. 5. Jack CONTROL IN/OUT: Quando si collegano amplificatori e dispositivi audio Pioneer è possibile il controllo centralizzato. Per esempio, è possibile controllare gli amplificatori e i dispositivi audio. It 5 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Telecomando 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. Tasto ^ STANDBY/ON: Quando l'unità è alimentata, consente di accendere l'unità o di passare alla modalità standby. Non è possibile accendere o spegnere l'unità con il telecomando. 2. Pulsante SHUFFLE: Impostare la ripetizione casuale. (P13) 3. Pulsante REPEAT: Consente di impostare la riproduzione ripetuta. (P13) 4. Tasti numerati: Possono essere utilizzati per immettere direttamente il numero del brano di un CD musicale durante la selezione dei brani. Possono essere utilizzati inoltre per immettere i numeri dei brani per la riproduzione programmata. 5. Pulsante CLEAR: Consente di eliminare il contenuto impostato per la riproduzione programmata. (P13) 6. Pulsante DIGITAL FILTER: Consente di selezionate uno dei tre tipi di DIGITAL FILTER. (P15) 7. Cursori, tasto ENTER: Selezionare la voce con i cursori e premere ENTER per confermare. 8. Pulsante SETUP: Consente di visualizzare il menu SETUP. (P16) 9. Tasti di riproduzione: u : Torna all'inizio del brano in riproduzione. Premere nuovamente per passare al brano precedente. /h : Avvia/mette in pausa la riproduzione. i : Passa al brano successivo. t : Tenere premuto per riavvolgere velocemente il brano in riproduzione. g : Arresta la riproduzione. y : Tenere premuto per mandare avanti velocemente il brano in riproduzione. 10.Pulsante SOURCE: Seleziona la sorgente da riprodurre. 11. Pulsante DIRECT: Consente di attivare/disattivare la modalità DIRECT. (P15) 12.Pulsante DISPLAY: Consente di cambiare le informazioni sul display. • A seconda della sorgente, l'operazione potrebbe non essere avviata. 13.Pulsante ; OPEN/CLOSE: Apre o chiude il piatto portadisco. 14.Pulsante PROGRAM: Da usare per programmare la riproduzione. (P13) 15.Pulsante LOCK RANGE: Consente di visualizzare la schermata delle impostazioni LOCK RANGE ADJUST. (P15) 16.Pulsante RETURN: Riporta il display allo stato precedente. 17.Tasto UP SAMPLING: Consente di impostare la funzione UP SAMPLING su ON e OFF. (P15) 18.Pulsante CD/SACD: Consente di scegliere tra CD e SACD come sorgente. Premendo questo pulsante durante la riproduzione di un disco SACD ibrido, viene modificato il layer in riproduzione. (P18) 19.Pulsante DIGITAL OUT: Consente di attivare e disattivare l'uscita digitale. (P16) 20.Pulsante DISPLAY OFF: Premere per spegnere il display di questa unità. Premere nuovamente per accendere il display. 21.Pulsante DIMMER: È possibile regolare la luminosità del display su tre livelli. (Valore predefinito: Livello 3) Rispettare la polarità quando si inseriscono le batterie. > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Display 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Si accende durante la riproduzione di SACD e DSD. 2. Visualizzazione messaggi: Mostra le informazioni sui brani e sui menu. 3. Si accende quando è possibile effettuare operazioni tramite i tasti cursore del telecomando. 4. Mostra lo stato di riproduzione. 5. Si accende quando l'impostazione dell'uscita audio digitale è attiva. (P16) 6. Si accende quando vengono mostrati elementi quali il tempo residuo di un brano o del disco oppure la durata totale del disco. 7. Appare quando viene riprodotto un file o streaming MQA. Per informazioni dettagliate, consultare il paragrafo "Riproduzione MQA". (P18) It 7 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Collegamenti con un amplificatore Installazione Questa unità 1 a 2 1 a a 2 Amplificatore integrato, ricevitore AV, ecc. Riprodurre l'audio da dischi riprodotti su questa unità e da dispositivi collegati a questa unità attraverso diffusori collegati ad amplificatori integrati o ricevitori AV. Eseguire il collegamento in modo idoneo ai terminali di ingresso dell'amplificatore. 8 a Cavo audio analogico Collegamento con un cavo audio analogico Il segnale viene convertito in analogico dal convertitore D/A di questa unità e poi inviato, ad esempio, a un amplificatore integrato. Collegare i terminali LINE IN di un amplificatore integrato al terminale ANALOG OUT (RCA) di questa unità. > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Collegamento con un cavo digitale ottico Il segnale viene convertito in analogico dal convertitore D/A dell'amplificatore integrato, ad esempio. Collegare il terminale OPTICAL IN di un amplificatore integrato al terminale DIGITAL OUT OPTICAL di questa unità. • L’audio di SACD e DSD o l’ingresso da USB DAC non viene emesso dal jack DIGITAL OUT OPTICAL di questa unità. • I segnali digitali che possono essere emessi da questa unità sono segnali lineari PCM con frequenza di campionamento e bit rate di quantizzazione di 192 kHz/ 24 bit (il funzionamento potrebbe non essere possibile con tutti i dispositivi collegati o in tutti gli ambienti). Collegamento con un cavo digitale coassiale Il segnale viene convertito in analogico dal convertitore D/A dell'amplificatore integrato, ad esempio. Collegare il terminale COAXIAL IN di un amplificatore integrato al terminale DIGITAL OUT COAXIAL di questa unità. • L’audio di SACD e DSD o l’ingresso da USB DAC non viene emesso dal jack DIGITAL OUT COAXIAL di questa unità. • I segnali digitali che possono essere emessi da questa unità sono segnali lineari PCM con frequenza di campionamento e bit rate di quantizzazione di 192 kHz/ 24 bit (il funzionamento potrebbe non essere possibile con tutti i dispositivi collegati o in tutti gli ambienti). It 9 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Terminale di controllo Se si possiedono diversi dispositivi Pioneer dotati di terminali CONTROL IN/OUT, è possibile controllarli tutti a livello centrale attraverso il sensore del telecomando sull'amplificatore, ad esempio. Effettuando il collegamento attraverso cavi minijack mono (senza resistori) come mostrato nell'immagine, anche se questa unità e altri dispositivi vengono posizionati in punti dai quali non sia possibile ricevere il segnale del telecomando, sarà comunque possibile usare il telecomando per controllare questa unità o altri dispositivi puntando il telecomando verso il relativo sensore sull'amplificatore, ad esempio. • Accertarsi anche di eseguire il collegamento con il cavo audio analogico. La sola connessione del terminale di controllo non è sufficiente per il funzionamento corretto del controllo centralizzato. • Il sensore del telecomando su questa unità smette di funzionare se si collega un cavo minijack mono (senza resistore) al terminale CONTROL IN di questa unità. • I sensori del telecomando sugli altri dispositivi smettono di funzionare se si collega un cavo minijack mono (senza resistore) al terminale CONTROL OUT di questa unità. • Se si effettua il collegamento di un lettore di rete e un amplificatore Pioneer attraverso il terminale CONTROL IN/OUT, è possibile eseguire operazioni di base su questa unità, sul lettore di rete e sull'amplificatore tramite un'app per smartphone usando la rete. (esempio di collegamento) IN OUT CONTROL a Amplificatore a Questa unità IN OUT CONTROL Dispositivo audio a Cavi minijack mono (senza resistori) 10 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Collegamento del cavo di alimentazione, ecc. 1 Collegamento del cavo di alimentazione 2 a a a Cavo di alimentazione Questo modello include un cavo di alimentazione estraibile. Il cavo di alimentazione deve essere collegato solo dopo che sono stati completati tutti gli altri collegamenti. Accertarsi che il cavo di alimentazione sia collegato al terminale AC IN dell’unità, poi collegarlo alla presa. Scollegare sempre prima il lato presa e successivamente il cavo di alimentazione. Avvio Premere 8 STANDBY/ON sull'unità principale. • All'avvio, premere fino a far rientrare il pulsante. All'avvio dell'unità, l'indicatore 8 STANDBY/ON posto al centro del pulsante si accende in blu. It 11 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Riproduzione di dischi Riproduzione 1 Per indicazioni sui dischi che possono essere riprodotti su questa unità, fare riferimento a (P18). Riproduzione di CD musicali Eseguire la procedura sotto descritta quando l'unità è accesa. 1. Premere CD/SACD sul telecomando per impostare la sorgente su CD/SACD. 2. Premere ; sull'unità principale per aprire il vassoio del disco, e dopo aver messo il disco sul vassoio, premere nuovamente ;. 3. Premere /h (g) sul telecomando per avviare la riproduzione. 4. Usare i tasti di riproduzione (h) per arrestare la riproduzione o scegliere i brani da riprodurre. È possibile selezionare anche immettendo il numero del brano usando i tasti numerici (b). Quando si immette il numero di un brano con 2 cifre, premere il tasto +10 per un numero di volte corrispondente al valore della seconda cifra (decine), quindi premere il valore della prima cifra. Premendo DISPLAY (d), è possibile alternare la visualizzazione in modo da vedere il tempo trascorso o il tempo rimanente del disco, ecc. • Il contenuto visualizzato dipende dal disco. 2 12 • La visualizzazione del nome del brano è supportata solamente con i file musicali in formato MP3/WMA/ FLAC/AAC (solo M4A)/DSD (solo DSF). • I caratteri che non possono essere visualizzati da questa unità appaiono come "". a e b c f Riproduzione di un disco contenente file musicali Eseguire la procedura sotto descritta quando l'unità è accesa. 1. Premere CD/SACD sul telecomando per impostare la sorgente su CD/SACD. 2. Premere ; sull'unità principale per aprire il vassoio del disco, e dopo aver messo il disco sul vassoio, premere nuovamente ;. 3. Premere /h (g) sul telecomando per avviare la riproduzione. 4. Usare i tasti di riproduzione (h) per arrestare la riproduzione o scegliere i brani da riprodurre. Premendo DISPLAY (d), è possibile alternare la visualizzazione in modo da vedere il tempo trascorso o il tempo rimanente del disco, il nome del file del brano o il nome del brano, ecc. • Il contenuto visualizzato dipende dal disco e dal file. g h d > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Riproduzione ripetuta 1. Premere ripetutamente REPEAT (a) durante la riproduzione per visualizzare ALL o 1 sul display. ALL : riproduzione ripetuta di tutti i brani. 1 : riproduce ripetutamente il brano in esecuzione. Per annullare la riproduzione ripetuta, premere REPEAT (a) diverse volte fino a visualizzare OFF sul display. Ripetizione casuale Specifiche dei file che possono essere riprodotti Frequenze di campionamento MP3 44,1/48 kHz WMA 44,1/48 kHz AAC 44,1/48/88,2/96 kHz 1. Premere SHUFFLE (f) durante la riproduzione o arrestarla per visualizzare sul display. : riproduce tutti brani in ordine casuale. Per annullare la riproduzione casuale, premere SHUFFLE (f) fino a visualizzare OFF sul display. AIFF Ripetizione programmata FLAC È possibile impostare l'ordine di riproduzione dei brani di un CD musicale. 1. Premere PROGRAM (e) quando non è in corso alcuna riproduzione. Se non è stato registrato nulla, viene visualizzato "P00". Immettere il numero del brano che si desidera registrate servendosi dei tasti numerici (b). Quando si immette il numero di un brano con 2 cifre, premere il tasto +10 per un numero di volte corrispondente al valore della seconda cifra (decine), quindi premere il valore della prima cifra. Il numero in "P00" aumenta ogni volta che si registra un brano. È possibile registrare fino a 24 brani. • Per riprodurre la programmazione registrata, premere /h (g) sul telecomando. • Premendo CLEAR (c) durante la registrazione dei brani, i brani vengono eliminati in ordine a partire dall'ultimo brano registrato. • Premendo PROGRAM (e) durante la registrazione dei brani, vengono eliminati tutti i brani registrati. • Se la durata di riproduzione totale del programma registrato è superiore a 99 minuti e 59 secondi, sul display viene visualizzato " : ". WAV ALAC DSD 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 44,1/48/88,2/96/ 176,4/192 kHz 2,8/5,6 MHz Bitrate Tra 8 kbps e 320 kbps e VBR. Tra 5 kbps e 192 kbps e VBR. Tra 8 kbps e 320 kbps e VBR. Bit di quantizzazione Tipi di dischi che possono essere riprodotti Estensione CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW – .mp3 – .wma – * .aac/ .m4a – 8/16/24 bit * .wav – 8/16/24 bit * .aif/ .aiff – 8/16/24 bit * .flac – 8/16/24 bit * .m4a – 1 bit – .dsf/ .dff .flac/ .wav 44,1/48/88,2/96/176,4/ * – 8/16/24 bit 192/352,8/384 kHz * Quando si riproducono file oltre i 48 kHz, usare file registrati su un DVD. Note riguardanti tutti i tipi di file • Usare dischi CD/CD-R/CD-RW conformi alla ISO9660 Livello 1/Livello 2 che definisce il tipo di file system per supporti CD-ROM registrati con un sistema conforme alla formattazione estesa (Joliet e Romeo). Quando si utilizzano dischi DVD, in aggiunta a quanto indicato sopra, usare dischi registrati con file system UDF. • La struttura delle cartelle è limitata a otto livelli e il numero massimo di brani è 3000. Tuttavia, a seconda della struttura delle cartelle, è possibile che non tutte le cartelle e non tutti i brani vengano riconosciuti e riprodotti. MQA Note riguardanti tipi specifici di file • Codificare i file WMA mediante applicazioni certificate dalla statunitense Microsoft Corporation. Se si utilizzano applicazioni non certificate, potrebbero verificarsi errori di funzionamento. • Questa unità supporta la riproduzione di file AAC con estensione ".m4a" codificati con iTunes. Tale riproduzione potrebbe tuttavia non essere possibile nel caso in cui il file sia protetto mediante sistema di protezione da copia DRM (tutela dei diritti d'autore) o altre versioni di iTunes usate per la codifica. • I file WAV includono audio digitale PCM non compresso. • I file AIFF includono audio digitale PCM non compresso. It 13 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Utilizzo di questa unità come convertitore D/A Su questa unità è possibile convertire l’audio digitale del PC in analogico ed emetterlo dai jack ANALOG OUT. 1 Commutazione della sorgente 1. Premere SOURCE su questa unità oppure sul telecomando per far passare la sorgente dell’unità a "USB DAC". USB DAC 2 Connessioni 2. Utilizzare un cavo USB di tipo A-B per effettuare il collegamento al computer. Riproduzione a 14 a Cavo USB 3. Avviare la riproduzione sul lettore. • I segnali digitali in ingresso che possono essere ammessi da questa unità sono segnali lineari PCM con frequenza di campionamento e bit rate di quantizzazione di 48 kHz/32 bit (il funzionamento potrebbe non essere possibile con tutti i dispositivi collegati o in tutti gli ambienti). • SO supportati del PC da collegare sono Windows10® e Mac OS X. • Con SO diversi da quelli supportati, il suono potrebbe interrompersi o non essere riprodotto. • A seconda dell’ambiente di utilizzo, la riproduzione potrebbe non funzionare correttamente. > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Regolazione della qualità audio Riproduzione fedele del suono originale (modalità DIRECT) Le elaborazioni che influenzano la qualità audio vengono disattivate, quindi viene riprodotto un suono più vicino all'originale. (Valore predefinito): OFF 1. Premere DIRECT (d). • L'indicatore DIRECT sulla parte anteriore dell'unità principale si illumina quando la modalità DIRECT è ON. • Quando la modalità DIRECT è ON, DIGITAL OUT è impostato su OFF. • In modalità DIRECT, il display si spegne automaticamente durante la riproduzione di CD o SACD, o quando si collega USB DAC. • Se si modifica l’impostazione durante la riproduzione, l’audio potrebbe interrompersi. DIGITAL FILTER Consente di selezionate uno dei tre tipi di DIGITAL FILTER. 1. L'impostazione cambia ogni volta che si preme DIGITAL FILTER (a). "SLOW": suono morbido e fluido "SHARP" (Valore predefinito): suono con maggiore struttura e carattere più deciso "SHORT": suono con una sensazione di avvio rapido e di avanzamento • È anche possibile premere SETUP (c) per visualizzare la schermata di impostazione DIGITAL FILTER dal menu SETUP. In questo caso, selezionare il valore di impostazione con / (b) sul telecomando. • L’impostazione è fissa su "SHORT" durante la riproduzione di MQA-CD o di un disco contente file musicali, o quando si utilizza USB DAC. • Se si modifica l’impostazione durante la riproduzione, l’audio potrebbe interrompersi. UP SAMPLING L'aumento della frequenza di campionamento aiuta a ottenere una riproduzione del suono con un livello di chiarezza maggiore. (Valore predefinito) : OFF 1. È inoltre possibile premere anche UP SAMPLING (g) per impostare questa funzione su ON e OFF. • Non è possibile utilizzare questa funzionalità quando la modalità DIRECT è impostata su ON o durante la riproduzione di SACD o DSD. • L’impostazione è fissa su "ON" durante la riproduzione di MQA-CD o di un disco contente file musicali, o quando si utilizza USB DAC. • Se si modifica l’impostazione durante la riproduzione, l’audio potrebbe interrompersi. Regolazione del range di blocco (LOCK RANGE ADJUST) • Se si modifica l’impostazione durante la riproduzione, l’audio potrebbe interrompersi. a e b f c d g La qualità audio viene migliorata restringendo il range di blocco per ridurre i suoni incidentali. Tuttavia, un eccessivo restringimento del range di blocco può causare interruzioni del suono e rumore. Regolare il range di blocco durante l'ascolto. (Valore predefinito): RANGE 6 1. Premere LOCK RANGE (e). 2. Selezionare il valore dell'impostazione con / (f) sul telecomando. Da "RANGE 6" (ampio) a "RANGE 1" (ristretto) • È anche possibile premere SETUP (c) per visualizzare la schermata di impostazione LOCK RANGE ADJUST dal menu SETUP. • L’impostazione è fissa su "6" durante la riproduzione di MQA-CD o di un disco contente file musicali, o quando si utilizza USB DAC. • LOCK RANGE ADJUST non ha alcun effetto sull'audio di SACD e DSD. It 15 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Impostazioni Avanzate Impostazioni avanzate 1 AUTO STANDBY LOCK RANGE ADJUST Questa impostazione mette automaticamente l'unità in standby dopo 20 minuti di inattività senza alcun ingresso audio. "ON" (Valore predefinito): L’unità entrerà automaticamente in modalità standby. "OFF": L’unità non entrerà automaticamente in standby. Regolazione del range di blocco. (P15) POWER ON PLAY Questa unità consente di configurare le impostazioni avanzate in modo da fornire un'esperienza ancora migliore. 1. Premere SETUP sul telecomando. AUTO STANDBY 2. Selezionare il contenuto o l'impostazione con i cursori sul telecomando, quindi premere ENTER per confermare la selezione. Per tornare alla schermata precedente, premere RETURN. È possibile definire l'impostazione in modo che la riproduzione del disco venga avviata automaticamente all'accensione di questa unità. • Utilizzando un timer automatico collegato esternamente, è possibile impostare la riproduzione con timer all'attivazione automatica dell'alimentazione. "ON": Per riprodurre i dischi automaticamente "OFF" (Valore predefinito): Per non riprodurre i dischi DIGITAL OUT Effettuare le impostazioni dell'uscita audio digitale. Se non si effettua il collegamento al terminale DIGITAL OUT OPTICAL/COAXIAL, è possibile godere di un audio ancora più nitido impostando questa opzione su OFF. "ON" (Valore predefinito), "OFF" DIGITAL FILTER È possibile selezionare il tipo di DIGITAL FILTER. (P15) UP SAMPLING 3. Per uscire dalle impostazioni, premere SETUP. 16 L'aumento della frequenza di campionamento aiuta a ottenere una riproduzione del suono con un livello di chiarezza maggiore. (P15) LOADING MODE È possibile abbreviare i tempi di caricamento per i CD. • L’attivazione di questa funzionalità consente di abbreviare i tempi di caricamento a seconda del CD, tuttavia il suono potrebbe risultare intermittente all’inizio della riproduzione. "NORMAL" (Valore predefinito): Se i tempi di caricamento per i CD non vengono abbreviati "FAST": Se i tempi di caricamento per i CD vengono abbreviati > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Risoluzione dei problemi Altri Prima di iniziare la procedura In caso di funzionamento instabile, i problemi potrebbero essere risolti semplicemente accendendo l'unità, passando alla modalità standby o scollegando/collegando il cavo di alimentazione, invece di intervenire su impostazioni e procedure operative. Provare queste semplici azioni sia sull’unità sia sul dispositivo connesso. Se, dopo aver fatto riferimento a "Risoluzione dei problemi", il problema persiste, il ripristino dell'unità allo stato in cui era al momento della spedizione potrebbe risolvere il problema. Resettare l'unità (questo resetta le impostazioni dell'unità ai valori predefiniti) 1. Quando l'alimentazione è attiva e non è inserito alcun disco, premere DIRECT tenendo premuto g sull'unità principale. 2. Compare il messaggio "CLEAR", l'unità va in standby e le impostazioni vengono resettate. CLEAR ■ Alimentazione Impossibile accendere l’unità • Scollegare il cavo di alimentazione dalla presa di corrente, attendere almeno 2 minuti, quindi ricollegarlo. L’unità si spegne inaspettatamente • L'unità va automaticamente in standby quando è impostato "AUTO STANDBY" nel menu SETUP. L'indicatore STANDBY sull'unità principale continua a lampeggiare in rosso e non sono possibili altre operazioni • Scollegare il cavo di alimentazione dalla presa di corrente, attendere almeno 2 minuti, quindi ricollegarlo. L'indicatore continuerà a lampeggiare, ma premere 8 STANDBY/ON sull'unità principale per attivare l'alimentazione (ON). Se questo non risolve il problema, • È possibile che il display sia stato spento premendo DISPLAY OFF. Premere DISPLAY OFF per accendere il display. • Installare nuove batterie. Non mescolare tipi diversi di batterie o batterie vecchie e nuove. • Assicurarsi che questa unità non sia esposta a luce solare diretta o a luci fluorescenti di tipo a invertitore. Riposizionare, se necessario. • Se questa unità è installata in uno scaffale o in un armadietto con sportelli di vetro colorato o se le porte sono chiuse, il telecomando potrebbe non funzionare in modo affidabile. ■ Impossibile riprodurre dischi ■ Funzionalità come convertitore D/A • Posizionare il disco sul piatto portadisco con il lato dell'etichetta rivolto verso l'alto. • La riproduzione potrebbe non essere possibile in presenza di graffi o sporco sul disco. • I file audio che sono protetti da copyright non possono essere riprodotti. • Il piatto portadisco si apre nel caso in cui venga inserito un disco non supportato da questa unità. • Assicurarsi che i dispositivi siano collegati correttamente. • Riprodurre l'audio compatibile tramite i terminali di ingresso di questa unità. (P14) potrebbe trattarsi di un malfunzionamento. Scollegare il cavo di alimentazione dalla presa a muro e contattare il rivenditore o la nostra assistenza clienti. ■ Il display non si illumina ■ Audio Impossibile riprodurre l'audio dai computer • Disattivare il muting sul computer. • Selezionare questa unità nelle impostazioni di uscita audio sul computer in uso. Se la sorgente di questa unità è impostata su un’opzione diversa da "USB DAC", il PC non riesce a rilevare questa unità. • Se sono presenti più applicazioni in esecuzione sul computer, chiudere quelle che non si stanno utilizzando. Il suono è interrotto • Un eccessivo restringimento del range di blocco nell'impostazione LOCK RANGE ADJUST può causare interruzioni del suono e rumore. Le interruzioni del suono causate dalla regolazione del range di blocco non sono coperte dalle nostre garanzie di funzionamento. Regolare il range di blocco durante l'ascolto. La frequenza di campionamento è sempre la stessa attraverso l'ingresso USB DAC • A seconda delle impostazioni del computer, le frequenze di campionamento dei file in riproduzione, anche se diverse, vengono convertite tutte nella stessa frequenza di campionamento. Suono digitale assente • Impostare "DIGITAL OUT" nel menu SETUP su "ON". • L’audio di SACD e DSD o l’ingresso da USB DAC non sono uscite digitali. Attraverso l'ingresso USB DAC vengono ricevuti anche gli altri suoni provenienti dal computer, non solo la musica • A seconda delle impostazioni del computer, suoni quali toni di avvio o di errore possono essere riprodotti tramite questa unità. ■ Telecomando ■ SACD • Assicurarsi che le batterie siano installate con la polarità corretta. • A causa di differenze nei metodi di registrazione, potrebbero verificarsi differenze di volume tra SACD e CD. It 17 > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Altre note ■ Dischi che possono essere riprodotti MQA-CD SACD (Super Audio CD) (solo area a 2 canali) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Precauzioni per la riproduzione • È possibile usare i compact disc (CD) con il seguente logo sull'etichetta. Riproduzione di SACD ibridi Un disco SACD ibrido è composto da due layer: SACD e CD. Premere CD/SACD per selezionare il layer che si desidera ascoltare. Riproduzione di DualDisc "DualDisc" è un disco con video e audio conformi allo standard DVD su un lato e audio riproducibile da un lettore CD sull'altro. Sul lato audio non DVD, la riproduzione potrebbe non essere sempre possibile poiché il disco non è conforme alle specifiche fisiche dei CD standard. Operazioni durante la riproduzione La ricerca diretta non è disponibile durante la riproduzione di dischi con dati musicali. • Notare che alcuni dischi potrebbero non essere riprodotti a causa di caratteristiche del disco, graffi, sporcizia o stato della registrazione. Tipi di dischi che non possono essere riprodotti con questa unità Riproduzione MQA Note sui dischi Questa unità è dotata della tecnologia MQA (Master Quality Authenticated) che consente la riproduzione di file audio e streaming MQA, garantendo il suono della registrazione originale master. Questa unità è un lettore CD in grado di riconoscere un MQA-CD. Il decoder MQA integrato ripristinerà il segnale ad alta risoluzione ascoltato nello studio e lo confermerà utilizzando la firma di autenticazione. Visitare il sito web www.mqa.co.uk/customer/mqacd per maggiori informazioni. “MQA” o “MQA.” indica che il prodotto decodifica e riproduce un file o streaming MQA, indicando la provenienza per garantire che il suono sia identico a quello del materiale sorgente. “MQA.” indica la riproduzione in corso di un file MQA Studio, approvato nello studio dall’artista/produttore o verificato dal titolare del diritto d’autore. 18 DVD Video, DVD Audio, CD-G, Video CD, DTS-CD • Fare attenzione a mani e dita durante l'apertura o la chiusura del piatto portadisco. • Non usare mai dischi con una forma particolare (come cuori o ottagoni). Questi tipi di dischi potrebbero incepparsi e danneggiare l'unità. • Alcuni CD audio con funzioni di controllo della copia non sono conformi agli standard ufficiali dei CD. Questi sono dischi particolari e non possono essere riprodotti con questa unità. • Non usare dischi con residui di nastro adesivo, dischi noleggiati con etichette che si staccano, o dischi con etichette decorative. Questo tipo di disco potrebbe rimanere incastrato nell'unità, o potrebbe danneggiare l'unità. • Non lasciare un disco con etichetta stampata con una stampante a getto d'inchiostro nell'unità a lungo. Il disco potrebbe rimanere incastrato nell'unità, o potrebbe danneggiare l'unità. ■ Pulizia del lettore • Normalmente, usare un panno soffice e pulito. Per lo sporco tenace, applicare del detergente neutro diluito in 5 o 6 parti di acqua ad un panno soffice, strizzarlo bene, pulir via lo sporco ed asciugare con un panno pulito e asciutto. • Tenere presente che l’alcool, il diluente, la benzina o l’insetticida sul lettore possono far sbiadire le finiture e cadere la vernice. Inoltre, evitare di lasciare oggetti in gomma o vinile a contatto col lettore per lunghi periodi, dato che questo può danneggiare le finiture del cabinet. • Se si usano panni trattati chimicamente o altri prodotti simili, leggerne attentamente le istruzioni. • Se risulta difficile eliminare la polvere accumulata sul piatto portadisco, applicare nastro adesivo, ecc. per rimuoverla. ■ Precauzioni durante lo spostamento dell'unità Durante lo spostamento dell'unità, estrarre il disco eventualmente presente e chiudere il piatto portadisco. Premere 8 STANDBY/ON sull'unità principale, attendere 10 secondi dopo la scomparsa del messaggio [OFF] dal display e scollegare il cavo di alimentazione. Lo spostamento dell'unità con un disco al proprio interno potrebbe causare danni. ■ Condensa Gocce d'acqua possono formarsi all'interno di questa unità se viene spostata da un luogo freddo ad una stanza calda o quando una stanza fredda viene rapidamente riscaldata da un calorifero. Questa viene chiamata condensa. Può causare non solo il malfunzionamento dell'unità, ma può anche danneggiare il disco o parti dell'unità. Raccomandiamo di rimuovere i dischi dall'unità se non viene usata per un pò di tempo. Se esiste la possibilità che si sia formata condensa, scollegare il cavo di alimentazione e lasciare l'unità per almeno 3 ore a temperatura ambiente. > Prima di iniziare > Nome dei componenti > Installazione > Riproduzione Impostazioni avanzate | Altri Caratteristiche generali ■ Uscita audio analogica ■ Altri Livello e impedenza di uscita nominale • RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100  Ingresso di controllo • Mini-jack Ø3,5 (mono) Risposta in frequenza • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Uscita di controllo • Mini-jack Ø3,5 (mono) Rapporto segnale-rumore • CD: 116 dB o superiore (correzione A), SACD: 116 dB o superiore (correzione A) ■ Generale THD+N • CD: 0,002 % o meno, SACD: 0,002 % o meno ■ Ingresso audio digitale USB DAC • Tipo B, classe audio USB 1.0 ■ Uscita audio digitale Uscita digitale coassiale • Terminale RCA, 0,5 Vp-p / 75  Alimentazione • CA 220 - 230 V, 50/60 Hz Consumo elettrico • 43 W • 0,3 W (in modalità standby) AUTO STANDBY • ON (20 min) / OFF Dimensioni (L  A  P) • 435 mm  138 mm  413 mm Peso • 13,1 kg Uscita digitale ottica • Terminale ottico, -14 - -21 dBm / 660 nm It 19 20 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere SUPER AUDIO CD PLAYER PD-50AE Bedienungsanleitung En Fr Es It De Nl Sv Vor dem Start Sicherheitshinweise ................................................................ 2 Lieferumfang ........................................................................... 3 Teilenamen Bedienfeld ............................................................................... 4 Rückseite ................................................................................ 5 Fernbedienung ....................................................................... 6 Display .................................................................................... 7 Installation Verbindungen mit einem Verstärker ....................................... 8 Anschließen des Netzkabels usw. .........................................11 Wiedergabe Wiedergabe von Discs .......................................................... 12 Verwenden dieses Geräts als D/A-Wandler ......................... 14 Anpassen der Klangqualität .................................................. 15 Erweiterte Einrichtung Erweiterte Einstellungen........................................................ 16 Andere Fehlerbehebung ................................................................... 17 Weitere Hinweise................................................................... 18 Allgemeine technische Daten ................................................ 19 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Sicherheitshinweise Vor dem Start WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR 'DV%OLW]V\PEROPLW3IHLOLQQHUKDOEHLQHVJOHLFKVHLWLJHQ'UHLHFNV VROOGHQ$QZHQGHUDXIGDV9RUKDQGHQVHLQYRQ³JHIlKUOLFKHQ 6SDQQXQJHQ´LP,QQHUHQGHV*HKlXVHVGLHVHV3URGXNWHV DXIPHUNVDPPDFKHQ'HUDUWLJH6SDQQXQJHQVLQGKRFKJHQXJ XPIU0HQVFKHQJHIlKUOLFKH6FKOlJH]XEHZLUNHQ 'DV$XVUXIXQJV]HLFKHQLQQHUKDOEHLQHVJOHLFKVHLWLJHQ 'UHLHFNVVROOGHQ$QZHQGHUDXIGDV9RUKDQGHQVHLQYRQ ZLFKWLJHQ%HWULHEVRGHU:DUWXQJVKLQZHLVHQ 6HUYLFH LQ GHUGHP3URGXNWEHLOLHJHQGHQ'RNXPHQWDWLRQKLQZHLVHQ 9256,&+7 806,&+1,&+7'(5*()$+5(,1(6(/(.75,6&+(16&+/$*(6 $86=86(7=(1'h5)(16,(1,&+7'(1'(&.(/ 2'(5',( 5h&.6(,7( (17)(51(1,0*(5b7(,11(5(1%(),1'(16,&+ .(,1(920%(187=(55(3$5,(5%$5(17(,/(h%(5/$66(1 6,(5(3$5$785(1'(048$/,),=,(57(1.81'(1',(167 :$5181* 806,&+1,&+7'(5*()$+5(,1(6(/(.75,6&+(16&+/$*(6 $86=86(7=(1'h5)(16,(1,&+7'(1'(&.(/ 2'(5',( 5h&.6(,7( (17)(51(1,0*(5b7(,11(5(1%(),1'(16,&+ .(,1(920%(187=(55(3$5,(5%$5(17(,/(h%(5/$66(1 6,(5(3$5$785(1'(048$/,),=,(57(1.81'(1',(167 'LHVHV*HUlWLVWQLFKWZDVVHUGLFKW=XU9HUPHLGXQJGHU*HIDKU YRQ%UDQGXQG6WURPVFKODJNHLQH%HKlOWHUPLW)OVVLJNHLWHQ ]% %OXPHQYDVHQXQGW|SIH LQGLH1lKHGHV*HUlWHVEULQJHQXQGGLHVHV YRU7URSIZDVVHU6SULW]ZDVVHU5HJHQXQG1lVVHVFKW]HQ .HLQH4XHOOHQRႇHQHU)ODPPHQ ]%HLQHEUHQQHQGH.HU]H DXIGLHVHV *HUlWVWHOOHQ %HZDKUHQ6LH%DWWHULHQQLFKWLQGLUHNWHP6RQQHQOLFKWRGHUDQDQGHUHQ H[WUHPKHLHQ2UWHQDXIZLH]%LP,QQHQUDXPHLQHV)DKU]HXJVRGHU LQGHU1lKHHLQHU+HL]XQJ'DGXUFKN|QQHQGLH%DWWHULHQDXVODXIHQ VLFKEHUKLW]HQH[SORGLHUHQRGHULQ%UDQGJHUDWHQ$XFKNDQQGLHVGLH /HEHQVGDXHUGHU%DWWHULHQYHUULQJHUQ .OHLQH7HLOHDXHUKDOEGHU5HLFKZHLWHYRQ.OHLQNLQGHUQXQG.LQGHUQ DXIEHZDKUHQ%HLXQEHDEVLFKWLJWHP9HUVFKOXFNHQLVWXQYHU]JOLFKHLQ $U]WDXI]XVXFKHQ ,P*HUlWHJHKlXVHVLQG9HQWLODWLRQVVFKOLW]HXQGDQGHUHgႇQXQJHQYRUJHVHKHQ GLHGD]XGLHQHQHLQHhEHUKLW]XQJGHV*HUlWHV]XYHUKLQGHUQXQGHLQHQ ]XYHUOlVVLJHQ%HWULHE]XJHZlKUOHLVWHQ8P%UDQGJHIDKUDXV]XVFKOLHHQ GUIHQGLHVHgႇQXQJHQDXINHLQHQ)DOOEORFNLHUWRGHUPLW*HJHQVWlQGHQ ]% =HLWXQJHQ7LVFKGHFNHQXQG*DUGLQHQ DEJHGHFNWZHUGHQXQGGDV*HUlWGDUI EHLP%HWULHEQLFKWDXIHLQHPGLFNHQ7HSSLFKRGHU%HWWDXIJHVWHOOWVHLQ 2 %HL(LQVHW]HQHLQHV$NNXVGHVIDOVFKHQ7\SVEHVWHKW([SORVLRQVJHIDKU (VEHVWHKW([SORVLRQVJHIDKUZHQQ%DWWHULHQLQRႇHQHV)HXHURGHUKHLH gIHQJHODQJHQRGHUPHFKDQLVFK]HUVW|UWRGHU]HUVFKQLWWHQZHUGHQ $&+781* %HLGLHVHP*HUlWKDQGHOWHVVLFK]ZDUXPHLQ/DVHUSURGXNWGHU.ODVVH GDVHQWVSUHFKHQGGHP6WDQGDUG6LFKHUKHLWIU/DVHUSURGXNWH,(& NODVVL¿]LHUWLVW 9RUVLFKWVPDQDKPHQ $FKWHQ6LHEHL$XIVWHOOXQJGHV*HUlWHVLQHLQHP6FKUDQNRGHU %FKHUERUGDXIHLQHHLQZDQGIUHLH/IWXQJ $QGHU2EHUVHLWHXQGGHQ6HLWHQPXVVHLQ)UHLUDXPYRQFPJHODVVHQ ZHUGHQ$QGHU5FNVHLWHPVVHQPLQGHVWHQVFPIUHLVHLQ=ZLVFKHQGHU 5FNVHLWHGHV6FKUDQNVRGHU%FKHUERUGVPXVVHLQ)UHLUDXPYRQPLQGHVWHQV FPJHODVVHQZHUGHQXPGLH$EIXKUGHU:DUPOXIW]XJHZlKUOHLVWHQ %HWULHEVXPJHEXQJ %HWULHEVWHPSHUDWXUXQG%HWULHEVOXIWIHXFKWLJNHLW&ELV& ) ELV) UHO)HXFKWHPD[ 9HQWLODWLRQVVFKOLW]HQLFKWEORFNLHUW (LQH$XIVWHOOXQJGLHVHV*HUlWDQHLQHPXQ]XUHLFKHQGEHOIWHWHQVHKU IHXFKWHQRGHUKHLHQ2UWLVW]XYHUPHLGHQXQGGDV*HUlWGDUIZHGHUGLUHNWHU 6RQQHQHLQVWUDKOXQJQRFKVWDUNHQ.XQVWOLFKWTXHOOHQDXVJHVHW]WZHUGHQ :LFKWLJHUKLQZHLV 'LHPRGHOOQXPPHUXQGGLHVHULHQQXPPHUGLHVHVJHUlWVEH¿QGHQVLFKDXIGHU JHUlWHUFNRGHUXQWHUVHLWH1RWLHUHQVLHGLHVHQXPPHUQDXIGHUEHLJHIJWHQ JDUDQWLHNDUWHXQGEHZDKUHQVLHGLHVH]XUNQIWLJHQUHIHUHQ]DQHLQHPVLFKHUHQRUWDXI $&+781* 0LWGHU1HW]WDVWHDQGLHVHP*HUlWZLUGQLFKWGLHJHVDPWH6WURP]XIXKU YRQGHU1HW]VWHFNGRVHXQWHUEURFKHQ8PGDV*HUlWYROOVWlQGLJYRP 1HW]]XWUHQQHQPXVVGHU1HW]VWHFNHUDXVGHU1HW]VWHFNGRVHJH]RJHQ ZHUGHQ'DKHUVROOWHGDV*HUlWVRDXIJHVWHOOWZHUGHQGDVVVWHWVHLQ XQEHKLQGHUWHU=XJDQJ]XU1HW]VWHFNGRVHJHZlKUOHLVWHWLVWGDPLWGHU 1HW]VWHFNHULQHLQHU1RWVLWXDWLRQVRIRUWDEJH]RJHQZHUGHQNDQQ8P %UDQGJHIDKUDXV]XVFKOLHHQVROOWHGHU1HW]VWHFNHUYRUHLQHPOlQJHUHQ 1LFKWJHEUDXFKGHV*HUlWHVEHLVSLHOVZHLVHZlKUHQGGHV8UODXEV JUXQGVlW]OLFKYRQGHU1HW]VWHFNGRVHJHWUHQQWZHUGHQ 'LHVHV*HUlWLVWIUGHQ+HLPJHEUDXFKYRUJHVHKHQ)DOOVEHL(LQVDW] ]XHLQHPDQGHUHP=ZHFN ]%/DQJ]HLWJHEUDXFK]XJHZHUEOLFKHQ =ZHFNHQLQHLQHP5HVWDXUDQWRGHU%HWULHELQHLQHP)DKU]HXJE]Z 6FKLႇ HLQH)XQNWLRQVVW|UXQJDXIWULWWGLHHLQH5HSDUDWXUGHV*HUlWHV HUIRUGHUOLFKPDFKWZHUGHQGLH5HSDUDWXUNRVWHQGHP.XQGHQVHOEVWGDQQ LQ5HFKQXQJJHVWHOOWZHQQGLH*DUDQWLHIULVWQRFKQLFKWDEJHODXIHQLVW 6LFKHUKHLWVKLQZHLVH]XPQHW]NDEHO )DVVHQ6LHGDV1HW]NDEHOVWHWVQXUDP6WHFNHUDQ=LHKHQ6LHGHQ1HW]VWHFNHU QLFKWDXVGHU1HW]VWHFNGRVHLQGHP6LHDP.DEHO]LHKHQXQGEHUKUHQ6LH GDV1HW]NDEHOQLFKWPLWIHXFKWHQRGHUQDVVHQ+lQGHQ$QGHUHQIDOOVNDQQHV]X .XU]VFKOVVHQXQG6WURPVFKOlJHQNRPPHQ3ODW]LHUHQ6LHZHGHUGLHVHV*HUlW QRFKDQGHUH*HJHQVWlQGHZLH0|EHODXIGHP1HW]NDEHOXQGNQLFNHQ6LHGDV .DEHOQLFKW9HUNQRWHQ6LHGDV.DEHOQLFKWXQGYHUNQSIHQVLHHVQLFKWPLWDQGHUHQ .DEHOQ)KUHQ6LHGDV1HW]NDEHOVRGDVVHVNHLQH6WROSHUJHIDKUGDUVWHOOW %HVFKlGLJWH1HW]NDEHOVWHOOHQHLQ%UDQGXQG6WURPVFKODJULVLNRGDUhEHUSUIHQ6LH UHJHOPlLJGHQ=XVWDQGGHV1HW]NDEHOV:HQQ6LH6FKlGHQIHVWVWHOOHQODVVHQ6LH GDV1HW]NDEHOEHLP+lQGOHURGHUHLQHPDXWRULVLHUWHQ6HUYLFH]HQWUXPHUVHW]HQ LASER KLASSE 1 ,QIRUPDWLRQHQIU$QZHQGHU]XU6DPPOXQJXQG(QW VRUJXQJYRQ$OWJHUlWHQXQGJHEUDXFKWHQ%DWWHULHQ Symbol für Geräte Symbolbeispiele für Batterien Pb 'LHVH6\PEROHDXIGHQ3URGXNWHQGHU9HUSDFNXQJXQGRGHU %HJOHLWGRNXPHQWHQEHGHXWHQGDVVJHEUDXFKWHHOHNWULVFKHXQG HOHNWURQLVFKH3URGXNWHXQG%DWWHULHQQLFKWEHUGHQ+DXVKDOWVPOO HQWVRUJWZHUGHQGUIHQ =XUULFKWLJHQ+DQGKDEXQJ5FNJHZLQQXQJXQG:LHGHUYHUZHUWXQJ YRQ$OWSURGXNWHQXQGJHEUDXFKWHQ%DWWHULHQEULQJHQ6LHGLHVHELWWH ]XGHQJHPlGHUQDWLRQDOHQ*HVHW]JHEXQJGDIU]XVWlQGLJHQ 6DPPHOVWHOOHQ 0LWGHUNRUUHNWHQ(QWVRUJXQJGLHVHU3URGXNWHXQG%DWWHULHQKHOIHQ 6LHGDEHLZHUWYROOH5HVVRXUFHQ]XVFKRQHQXQGYHUPHLGHQ P|JOLFKHQHJDWLYH$XVZLUNXQJHQDXIGLH*HVXQGKHLWXQGGLH 8PZHOWGLHGXUFKHLQHXQVDFKJHPlH%HKDQGOXQJGHV$EIDOOV HQWVWHKHQN|QQWHQ :HLWHUH,QIRUPDWLRQHQ]XU6DPPOXQJXQG:LHGHUYHUZHUWXQJ YRQ$OWSURGXNWHQXQG%DWWHULHQHUKDOWHQ6LHYRQ,KUHU|UWOLFKHQ *HPHLQGHYHUZDOWXQJ,KUHP0OOHQWVRUJHURGHUGHP9HUNDXIVRUW DQGHP6LHGLH:DUHQHUZRUEHQKDEHQ 'LHVH6\PEROHJHOWHQDXVVFKOLHOLFKLQGHU(XURSlLVFKHQ8QLRQ )U/lQGHUDXHUKDOEGHU(XURSlLVFKHQ8QLRQ :HQQ6LHGLHVH*HJHQVWlQGHHQWVRUJHQZROOHQZHQGHQ6LHVLFK ELWWHDQ,KUHORNDOHQ%HK|UGHQRGHU+lQGOHUXQGIUDJHQ6LHGRUW QDFKGHUNRUUHNWHQ(QWVRUXQJVZHLVH :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Lieferumfang 1. 2. 3. 4. • 1 2 4 3 Hauptgerät (1) Fernbedienung (RC-980C) (1), Batterien (AAA/R03) (2) Analoges Audiokabel (für den Testbetrieb) (1) Netzkabel (1) Bedienungsanleitung (das vorliegende Dokument) (1) • Das Netzkabel darf erst angeschlossen werden, wenn alle anderen Kabelverbindungen hergestellt wurden. • Wir übernehmen keine Haftung für Schäden, die beim Anschließen von Drittanbietergeräten entstehen. • Änderungen der technischen Daten und des Erscheinungsbildes ohne vorherige Ankündigung vorbehalten. Das Gerät kann nicht mit der Fernbedienung ein-/ausgeschaltet werden. Verwenden Sie dazu die 8 STANDBY/ON-Taste am Hauptgerät. De 3 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Bedienfeld Teilenamen 1 6 2 3 7 8 9 1. 8 STANDBY/ON-Taste/-Anzeige: Hier wird das Gerät ein-/ausgeschaltet. Beim Gerätestart leuchtet die Anzeige in der Mitte der Taste blau auf. 2. STANDBY Anzeige: Leuchtet rot, wenn sich das Gerät im Standby-Modus befindet. 3. Disc-Fach: Geben Sie Discs hier ein. Es können auch 8-cm-Discs verwendet werden. 4. ; Taste: Öffnen/Schließen Sie das Disc-Fach. 5. Wiedergabetasten: u t : Zurück zum Anfang des Tracks, der gerade wiedergegeben wird. Noch einmal drücken, um zum vorigen Track zu springen. Gedrückt halten, um einen schnellen Rücklauf des Tracks auszuführen. q/h : Wiedergabe starten/pausieren. y i : Hiermit können Sie während der Wiedergabe zum nächsten Track springen. Gedrückt halten, um einen schnellen Vorlauf des Tracks auszuführen. g : Mit dieser Taste wird die Wiedergabe gestoppt. 4 4 5 bk bl 6. Fernbedienungssensor • Der Empfangsbereich der Fernbedienung liegt in einem Abstand von ca. 16´/5 m und einem Winkel von 20° in vertikaler Richtung und 30° nach rechts und links. 7. CD/SACD-Taste/-Anzeige: Schaltet zwischen CD/SACD als Quelle um. Wird dieser Schalter während der Wiedergabe einer Hybrid-SACD gedrückt, wird die wiedergegebene Schicht gewechselt. (P18) Die Anzeige leuchtet blau, wenn SACD ausgewählt ist. 8. DIRECT-Taste/-Anzeige: Schalten Sie den DIRECT-Modus ein/aus. (P15) Die Anzeige leuchtet blau, wenn der DIRECT-Modus eingeschaltet ist. 9. Display (P7) 10.SOURCE Taste: Wechselt die Wiedergabequelle. 11. SETUP Taste: Zeigt das SETUP-Menü an. (P16) > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Rückseite 1 2 3 4 5 1. ANALOG OUT-Buchse: Verwenden Sie ein analoges Audiokabel, um beispielsweise einen integrierten Verstärker anzuschließen. 2. AC IN: Schließen Sie das mitgelieferte Netzkabel an. 3. USB DAC-Anschluss: Verwenden Sie ein USB-Kabel (A-B-Typ), um einen Computer anzuschließen. 4. DIGITAL OUT OPTICAL/COAXIAL-Buchse: Verwenden Sie ein digitales optisches Kabel oder ein digitales Koaxialkabel, um beispielsweise einen integrierten Verstärker anzuschließen. 5. CONTROL IN/OUT-Buchse: Werden Verstärker oder Audiogeräte von Pioneer angeschlossen, ist eine zentrale Bedienung dieser Geräte möglich. De 5 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Fernbedienung 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. ^ STANDBY/ON-Taste: Wenn das Gerät eingeschaltet ist, wird es hiermit ausgeschaltet bzw. in den StandbyModus geschaltet. Das Gerät kann nicht mit der Fernbedienung ein-/ausgeschaltet werden. 2. SHUFFLE Taste: Stellen Sie die zufällige Wiedergabe ein. (P13) 3. REPEAT Taste: Stellen Sie die wiederholte Wiedergabe ein. (P13) 4. Zifferntasten: Hiermit können Sie bei der Suche nach Tracks direkt die Track-Nummer einer Musik-CD eingeben. Auch verwendet, um Track-Nummern für die Programmwiedergabe einzugeben. 5. CLEAR Taste: Löscht die für die Programmwiedergabe festgelegten Inhalte. (P13) 6. DIGITAL FILTER Taste: Wählt zwischen drei Arten von DIGITAL FILTER. (P15) 7. Cursortasten, ENTER-Taste: Wählen Sie das Element mit den Cursortasten aus und drücken Sie zum Bestätigen ENTER. 8. SETUP Taste: Zeigt das SETUP-Menü an. (P16) 9. Wiedergabetasten: u : Zurück zum Anfang des Tracks, der gerade wiedergegeben wird. Noch einmal drücken, um zum vorigen Track zu springen. /h : Wiedergabe starten/pausieren. i : Weiter zum nächsten Track. t : Gedrückt halten, um im aktuellen Track schnell zurückzuspulen. g : Wiedergabe stoppen. y : Gedrückt halten, um im aktuellen Track schnell vorzuspulen. 10.SOURCE Taste: Wechselt die Wiedergabequelle. 11. DIRECT Taste: Schalten Sie den DIRECT-Modus ein/ aus. (P15) 12.DISPLAY Taste: Schaltet die Informationen auf der Anzeige um. • Je nach Quelle wird der Vorgang möglicherweise nicht gestartet. 13.; OPEN/CLOSE Taste: Öffnen/Schließen Sie das DiscFach. 14.PROGRAM Taste: Wird für die Programmwiedergabe verwendet. (P13) 15.LOCK RANGE Taste: Der LOCK RANGE ADJUSTEinstellungsbildschirm wird angezeigt. (P15) 16.RETURN Taste: Stellt die vorige Anzeige wieder her. 17.UP SAMPLING-Taste: Schalten Sie die Funktion UP SAMPLING auf ON und OFF. (P15) 18.CD/SACD-Taste: Schaltet zwischen CD/SACD als Quelle um. Wird dieser Schalter während der Wiedergabe einer Hybrid-SACD gedrückt, wird die wiedergegebene Schicht gewechselt. (P18) 19.DIGITAL OUT Taste: Schaltet den Digitalausgang ein und aus. (P16) 20.DISPLAY OFF Taste: Schalten Sie das Display dieses Geräts aus. Noch einmal drücken, um das Display einzuschalten. 21.DIMMER Taste: Sie können die Helligkeit des Displays in drei Schritten anpassen. (Standardwert: Stufe 3) Beachten Sie die Polarität beim Einsetzen der Batterien. > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Display 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Leuchtet während der SACD- und DSD-Wiedergabe. 2. Anzeige von Meldungen: Hier werden Informationen zu Tracks und Menüs angezeigt. 3. Leuchtet, wenn Bedienvorgänge mit den Cursortasten der Fernbedienung möglich sind. 4. Der Wiedergabestatus wird angezeigt. 5. Leuchtet, wenn die Einstellung der digitalen Audioausgabe aktiviert ist. (P16) 6. Leuchtet, wenn Informationen wie die verbleibende Zeit des Tracks oder der Disc oder die Gesamtspielzeit der Disc angezeigt werden. 7. Anzeige, wenn eine MQA-Datei oder ein Stream abgespielt wird. Einzelheiten siehe "Wiedergabe von MQA". (P18) De 7 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Verbindungen mit einem Verstärker Installation Dieses Gerät 1 a 2 1 a 2 a Integrierter Verstärker, AV-Receiver usw. Sie können den Ton einer auf diesem Gerät abgespielten Disc sowie von anderen Geräten, die mit diesem Gerät verbunden sind, über Lautsprechersysteme wiedergeben, welche an integrierte Verstärker oder AV-Receiver angeschlossen sind. Nehmen Sie den Anschluss je nach Eingangsbuchsen an Ihrem Verstärker vor. 8 a Analoges Audiokabel Anschließen über ein analoges Audiokabel Das Signal wird vom D/A-Wandler dieses Geräts in ein analoges Signal umgewandelt und dann beispielsweise an einen integrierten Verstärker ausgegeben. Verbinden Sie die LINE-IN-Buchsen eines integrierten Verstärkers mit der ANALOG OUT-Buchse (RCA-Buchse) an diesem Gerät. > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Anschluss über ein digitales optisches Kabel Das Signal wird z. B. vom D/A-Wandler des integrierten Verstärkers in ein analoges Signal umgewandelt. Verbinden Sie die OPTICAL IN-Buchse eines integrierten Verstärkers mit der DIGITAL OUT OPTICAL-Buchse an diesem Gerät. • Das Audio von SACD und DSD oder Eingabe von USB DAC wird nicht von der DIGITAL OUT OPTICAL-Buchse dieses Geräts ausgegeben. • Bei den digitalen Signalen, die von diesem Gerät ausgegeben werden können, handelt es sich um lineare PCM-Signale mit einer Abtastfrequenz und Quantisierungs-Bitrate von 192 kHz/24 Bit (der Betrieb kann nicht mit allen Geräten und in allen Umgebungen gewährleistet werden). Anschluss über ein digitales Koaxialkabel Das Signal wird z. B. vom D/A-Wandler des integrierten Verstärkers in ein analoges Signal umgewandelt. Verbinden Sie die COAXIAL IN-Buchse eines integrierten Verstärkers mit der DIGITAL OUT COAXIAL-Buchse an diesem Gerät. • Das Audio von SACD und DSD oder Eingabe von USB DAC wird nicht von der DIGITAL OUT COAXIAL-Buchse dieses Geräts ausgegeben. • Bei den digitalen Signalen, die von diesem Gerät ausgegeben werden können, handelt es sich um lineare PCM-Signale mit einer Abtastfrequenz und Quantisierungs-Bitrate von 192 kHz/24 Bit (der Betrieb kann nicht mit allen Geräten und in allen Umgebungen gewährleistet werden). De 9 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere CONTROL-Buchse Wenn Sie über mehrere Pioneer-Markengeräte verfügen, die CONTROL IN/OUT-Buchsen aufweisen, können Sie sie z. B. zentral über den Fernbedienungssensor des Verstärkers bedienen. Bei Verbinden mit MonoMinisteckerkabeln (ohne Widerstände) wie in der Abbildung gezeigt können Sie auch dann die Fernbedienung verwenden, um dieses Gerät und andere Geräte zu bedienen, wenn sich die Geräte an Standorten befinden, an denen sie vom Fernbedienungssignal nicht erreicht werden können. Richten Sie dazu den Fernbedienungssensor z. B. auf den Verstärker. • Achten Sie darauf, zum Anschließen das analoge Audiokabel zu verwenden. Über die Control-Buchse alleine ist keine zentrale Bedienung möglich. • Wenn Sie ein Mono-Ministeckerkabel (ohne Widerstand) an die CONTROL IN-Buchse dieses Geräts anschließen, funktioniert der Fernbedienungssensor an diesem Gerät nicht mehr. • Wenn Sie ein Mono-Ministeckerkabel (ohne Widerstand) an die CONTROL OUT-Buchse dieses Geräts anschließen, funktionieren die Fernbedienungssensoren an den anderen Geräten nicht mehr. • Wenn ein Netzwerk-Player der Marke Pioneer mit Verstärker an die CONTROL IN/OUT-Buchse angeschlossen wird, können Sie mithilfe einer Smartphone-App grundlegende Bedienvorgänge an diesem Gerät, dem Netzwerk-Player und dem Verstärker über das Netzwerk vornehmen. 10 (Anschlussbeispiel) IN OUT CONTROL a Verstärker a Dieses Gerät IN OUT CONTROL Audiogerät a Mono-Ministeckerkabel (ohne Widerstand) > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Anschließen des Netzkabels usw. 1 Anschließen des Netzkabels 2 a a a Netzkabel Diesem Modell liegt ein abtrennbares Netzkabel bei. Das Netzkabel darf erst angeschlossen werden, wenn alle anderen Anschlüsse vorgenommen wurden. Achten Sie darauf, das Netzkabel zunächst mit dem AC IN-Anschluss am Gerät und anschließend mit der Steckdose zu verbinden. Trennen Sie immer zuerst die Verbindung zur Steckdose, wenn Sie das Netzkabel abziehen. Gerätestart Drücken Sie 8 STANDBY/ON am Hauptgerät. • Drücken Sie beim Gerätestart die Taste in das Gehäuse hinein. Beim Gerätestart leuchtet die Anzeige 8 STANDBY/ON in der Mitte der Taste blau auf. De 11 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Wiedergabe von Discs Wiedergabe 1 Informationen zu den Discs, die auf diesem Gerät wiedergegeben werden können, finden Sie unter (P18). Wiedergabe von Musik-CDs Führen Sie den folgenden Schritten aus, wenn das Gerät eingeschaltet ist. 1. Drücken Sie CD/SACD auf der Fernbedienung, um CD/ SACD als Quelle einzustellen. 2. Drücken Sie ; am Hauptgerät, um das Disc-Fach zu öffnen. Drücken Sie nach Einlegen einer Disc erneut ;, um das Fach zu schließen. 3. Drücken Sie /h (g) auf der Fernbedienung, um die Wiedergabe zu starten. 4. Verwenden Sie die Wiedergabetasten (h), um die Wiedergabe zu stoppen oder Tracks zur Wiedergabe auszuwählen. Sie können die Auswahl auch vornehmen, indem Sie die TrackNummer mit den Zifferntasten (b) eingeben. Zur Eingabe einer zweistelligen Track-Nummer drücken Sie die +10-Taste so oft, wie der Wert der Zehnerstelle ist, und drücken Sie dann die Zifferntaste für die Einerstelle. Durch Drücken von DISPLAY (d) können Sie auswählen, ob die abgelaufene oder verbleibende Wiedergabezeit der Disc usw. angezeigt werden soll. • Die angezeigten Informationen sind von der Disc abhängig. • Die Anzeige des Track-Namens wird nur bei Musikdateien in den Formaten MP3/WMA/FLAC/AAC (nur M4A)/DSD (nur DSF) unterstützt. • Zeichen, die auf diesem Gerät nicht dargestellt werden können, werden als "" angezeigt. a e b c f Wiedergabe von Discs mit Musikdateien 2 12 Führen Sie den folgenden Schritten aus, wenn das Gerät eingeschaltet ist. 1. Drücken Sie CD/SACD auf der Fernbedienung, um CD/ SACD als Quelle einzustellen. 2. Drücken Sie ; am Hauptgerät, um das Disc-Fach zu öffnen. Drücken Sie nach Einlegen einer Disc erneut ;, um das Fach zu schließen. 3. Drücken Sie /h (g) auf der Fernbedienung, um die Wiedergabe zu starten. 4. Verwenden Sie die Wiedergabetasten (h), um die Wiedergabe zu stoppen oder Tracks zur Wiedergabe auszuwählen. Durch Drücken von DISPLAY (d) können Sie auswählen, ob die abgelaufene oder verbleibende Wiedergabezeit der Disc, der Dateiname des Tracks, der Track-Name usw. angezeigt werden soll. • Die angezeigten Inhalte sind von der Disc und der Datei abhängig. g h d > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Wiederholte Wiedergabe 1. Drücken Sie bei der Wiedergabe mehrfach REPEAT (a), bis ALL oder 1 auf dem Display angezeigt wird. ALL : Wiederholung aller Tracks. 1 : Wiederholung des gerade wiedergegebenen Tracks. Zum Abbrechen der wiederholten Wiedergabe drücken Sie REPEAT (a) mehrmals, um OFF auf dem Display anzuzeigen. Zufällige Wiedergabe 1. Drücken Sie SHUFFLE (f) während der Wiedergabe oder im Stoppbetrieb, um auf dem Display anzuzeigen. : Zufallswiedergabe aller Tracks. Zum Abbrechen der zufälligen Wiedergabe drücken Sie SHUFFLE (f), um OFF auf dem Display anzuzeigen. Merkmale der Dateien, die wiedergegeben werden können Abtastraten MP3 WMA AAC WAV Programmwiedergabe AIFF Sie können die Wiedergabereihenfolge der Tracks auf einer Musik-CD einstellen. 1. Drücken Sie PROGRAM (e), während die Wiedergabe angehalten ist. "P00" wird angezeigt, wenn noch keine Registrierung erfolgt ist. Geben Sie mit den Zifferntasten (b) die Track-Nummer ein, die Sie registrieren möchten. Zur Eingabe einer zweistelligen Track-Nummer drücken Sie die +10-Taste so oft, wie der Wert der Zehnerstelle ist, und drücken Sie dann die Zifferntaste für die Einerstelle. Die Zahl in "P00" erhöht sich jedes Mal, wenn ein Track registriert wurde. Es können bis zu 24 Tracks registriert werden. • Drücken Sie auf der Fernbedienung /h (g), um das registrierte Programm wiederzugeben. • Wenn Sie während der Registrierung von Tracks CLEAR (c) drücken, werden die Tracks in der umgekehrten Reihenfolge der Eingabe gelöscht, beginnend mit dem zuletzt registrierten Track. • Wenn Sie während der Registrierung von Tracks PROGRAM (e) drücken, werden alle registrierten Tracks gelöscht. • Wenn die gesamte Spielzeit des registrierten Programms 99 Minuten 59 Sekunden überschreitet, wird " : " auf dem Display angezeigt. FLAC ALAC DSD Bitraten 8 kbps bis 320 kbps und VBR. 5 kbps bis 192 kbps 44,1/48 kHz und VBR. 8 kbps bis 320 kbps 44,1/48/88,2/96 kHz und VBR. 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48 kHz 2,8/5,6 MHz – Quantisierungsbit Disc-Typen, die wiedergegeben werden können CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW Erweiterung – .mp3 – .wma – * .aac/ .m4a 8/16/24 Bit * .wav 8/16/24 Bit * .aif/ .aiff 8/16/24 Bit * .flac 8/16/24 Bit * .m4a 1 Bit – .dsf/ .dff .flac/ .wav 44,1/48/88,2/96/176,4/ * – 8/16/24 Bit 192/352,8/384 kHz * Dateien mit mehr als 48 kHz müssen von einer DVD wiedergegeben werden. Hinweise zu allen Dateitypen • Verwenden Sie CD/CD-R/CD-RW-Discs, die dem CD-ROM-Dateisystemstandard ISO9660 Level 1/Level 2 entsprechen und mit erweiterter Formatierung (Joliet und Romeo) geschrieben wurden. Bei DVD-Discs gilt zusätzlich, dass die Disc mit dem UDF-Dateisystem geschrieben sein muss. • Die Ordnerstruktur ist auf acht Ebenen begrenzt. Die maximale Anzahl der Tracks beträgt 3000. Je nach Ordnerstruktur können jedoch möglicherweise nicht alle Ordner und Tracks erkannt und wiedergegeben werden. MQA Hinweise zu bestimmten Dateitypen • Codieren Sie WMA-Dateien mit Anwendungen, die von Microsoft Corporation in den Vereinigten Staaten zertifiziert wurden. Bei Verwendung nicht zertifizierter Anwendungen können Funktionsstörungen auftreten. • Dieses Gerät unterstützt die Wiedergabe von AAC-Dateien mit der Erweiterung ".m4a", die mit iTunes codiert wurden. Dateien, die mit DRM-Kopierschutz (Urheberrechtsschutz) geschützt sind oder mit bestimmten Versionen von iTunes codiert wurden, können jedoch möglicherweise nicht wiedergegeben werden. • WAV-Dateien enthalten unkomprimiertes digitales PCM-Audio. • AIFF-Dateien enthalten unkomprimiertes digitales PCM-Audio. De 13 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Verwenden dieses Geräts als D/A-Wandler Sie können die digitalen Audiosignale vom PC auf diesem Gerät in analoge Signale umwandeln und dann über die ANALOG OUT-Buchsen ausgeben. 1 Quelle umschalten 1. Drücken Sie SOURCE an diesem Gerät oder an der Fernbedienung, um die Quelle des Geräts auf "USB DAC" umzuschalten. USB DAC 2 Anschlüsse 2. Verwenden Sie ein USB-Kabel (A-B-Typ), um einen Computer anzuschließen. Wiedergabe a 14 a USB-Kabel 3. Starten Sie die Wiedergabe am Player. • Bei den digitalen Signalen, die von diesem Gerät ausgegeben werden können, handelt es sich um lineare PCM-Signale mit einer Abtastfrequenz bzw. Quantisierungs-Bitrate von 48 kHz/32 Bit (der Betrieb kann nicht mit allen Geräten und in allen Umgebungen gewährleistet werden). • Die unterstützten Betriebssysteme des anzuschließenden PCs sind Windows10® und Mac OS X. • Bei anderen als den unterstützten Betriebssystemen wird der Ton möglicherweise unterbrochen oder nicht ausgegeben. • Abhängig von der Art der Verwendungsumgebung kann die Wiedergabe u. U. nicht ordnungsgemäß ausgeführt werden. > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Anpassen der Klangqualität Der Originalklang wird naturgetreu reproduziert (DIRECT-Modus) Verarbeitungen, welche die Klangqualität beeinträchtigen, werden ausgeschaltet, damit ein naturgetreuerer Klang ausgegeben werden kann. (Standardwert): OFF 1. Drücken Sie DIRECT (d). • Die DIRECT-Anzeige an der Vorderseite des Hauptgeräts leuchtet, wenn der DIRECT-Modus auf ON gestellt ist. • Wenn der DIRECT-Modus auf ON gestellt ist, wird DIGITAL OUT auf OFF geschaltet. • Im DIRECT-Modus wird das Display bei der CD- und SACD-Wiedergabe oder bei Anschließen von USB DAC automatisch ausgeschaltet. • Wenn Sie die Einstellung während der Wiedergabe ändern, wird der Klang möglicherweise unterbrochen. DIGITAL FILTER Wählt zwischen drei Arten von DIGITAL FILTER. 1. Die Einstellung ändert sich bei jedem Drücken von DIGITAL FILTER (a). "SLOW": Weicher, flüssiger Klang "SHARP" (Standardwert): Klang mit mehr Struktur und Kontur "SHORT": Zügiger, dynamischer Klang • Sie können auch SETUP (c) drücken, um den DIGITAL FILTER-Einstellungsbildschirm aus dem SETUP-Menü zu öffnen. In diesem Fall wählen Sie den einzustellenden Wert mit / (b) auf der Fernbedienung aus. • Die Einstellung ist fest auf "SHORT" gesetzt, während MQA-CD oder eine Disc mit Musikdateien abgespielt wird, oder bei Verwendung von USB DAC. • Wenn Sie die Einstellung während der Wiedergabe ändern, wird der Klang möglicherweise unterbrochen. UP SAMPLING Durch ein Erhöhen der Abtastfrequenz kann eine Klangreproduktion mit höherer Klarheit erzielt werden. (Standardwert) : OFF 1. Sie können auch UP SAMPLING (g) drücken, um die Funktion auf ON und OFF zu schalten. • Diese Funktion kann nicht verwendet werden, wenn der Modus DIRECT auf ON während der Wiedergabe von SACD oder DSD gestellt ist. • Die Einstellung ist fest auf "ON" gesetzt, während MQA-CD oder eine Disc mit Musikdateien abgespielt wird, oder bei Verwendung von USB DAC. • Wenn Sie die Einstellung während der Wiedergabe ändern, wird der Klang möglicherweise unterbrochen. Sperrbereich anpassen (LOCK RANGE ADJUST) Die Klangqualität wird erhöht, indem der Sperrbereich für Zufallsgeräusche verringert wird. Wird der Sperrbereich jedoch zu stark verringert, kann es zu Wiedergabeunterbrechungen und Störgeräuschen kommen. Passen Sie den Sperrbereich während einer Audiowiedergabe an. (Standardwert): RANGE 6 1. Drücken Sie LOCK RANGE (e). 2. Wählen Sie den einzustellenden Wert mit / (f) auf der Fernbedienung aus. "RANGE 6" (breit) bis "RANGE 1" (schmal) • Sie können auch SETUP (c) drücken, um den LOCK RANGE ADJUST-Einstellungsbildschirm aus dem SETUP-Menü zu öffnen. • Die Einstellung ist fest auf "6" gesetzt, während MQA-CD oder eine Disc mit Musikdateien abgespielt wird, oder bei Verwendung von USB DAC. • LOCK RANGE ADJUST hat keine Auswirkung auf die SACD- und DSD-Wiedergabe. • Wenn Sie die Einstellung während der Wiedergabe ändern, wird der Klang möglicherweise unterbrochen. a e b f c d g De 15 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Erweiterte Einstellungen Erweiterte Einrichtung 1 Mit den erweiterten Einstellungen dieses Geräts können Sie Leistung und Bedienfreundlichkeit individuell anpassen. 1. Drücken Sie SETUP auf der Fernbedienung. AUTO STANDBY 2. Wählen Sie den Inhalt oder die Einstellung mit den Cursortasten der Fernbedienung aus und drücken Sie ENTER, um die Auswahl zu bestätigen. Um zum vorigen Bildschirm zurückzukehren, drücken Sie RETURN. AUTO STANDBY UP SAMPLING Diese Einstellung schaltet das Gerät nach 20 Minuten Inaktivität ohne Audioeingang automatisch in den StandbyModus. "ON" (Standardwert): Das Gerät schaltet automatisch in den Standby-Modus. "OFF": Das Gerät wird nicht automatisch in den StandbyModus geschaltet. Durch ein Erhöhen der Abtastfrequenz kann eine Klangreproduktion mit höherer Klarheit erzielt werden. (P15) POWER ON PLAY LOADING MODE Sie können das Gerät so einstellen, dass es nach dem Einschalten automatisch die eingelegte Disc abspielt. • Durch automatisches Einschalten der Stromversorgung mittels einer extern angeschlossenen Zeitschaltuhr können Sie eine zeitgesteuerte Wiedergabe einstellen. "ON": Discs werden automatisch wiedergegeben "OFF" (Standardwert): Discs werden nicht automatisch wiedergegeben Die Ladezeit für CD kann verkürzt werden. • Durch Aktivieren dieser Funktion kann die Ladezeit je nach CD verkürzt werden, zu Beginn der Wiedergabe kann es jedoch zu Klangaussetzern kommen. "NORMAL" (Standardwert): Wenn die Ladezeit für CD nicht verkürzt wird "FAST": Wenn die Ladezeit für CD verkürzt wird DIGITAL OUT Nehmen Sie Einstellungen für die digitale Audioausgabe vor. Wird die Verbindung nicht über die Buchse DIGITAL OUT OPTICAL/COAXIAL hergestellt, wird der Ton noch klarer wiedergegeben, wenn Sie diesen Wert auf OFF stellen. "ON" (Standardwert), "OFF" DIGITAL FILTER Sie konnen auswahlen, welche Art von DIGITAL FILTER verwendet werden soll. (P15) 3. Drücken Sie SETUP, um die Einstellungen zu verlassen. 16 LOCK RANGE ADJUST Sie können den Sperrbereich anpassen. (P15) > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Fehlerbehebung Andere Bevor Sie den Vorgang starten Bei instabilem Betrieb können Probleme möglicherweise durch einfaches Aus-/Einschalten, Schalten in den StandbyModus oder Abtrennen und erneutes Anschließen des Netzkabels anstatt durch Überprüfen von Einstellungen und Bedienvorgängen behoben werden. Versuchen Sie die einfachen Maßnahmen jeweils am Gerät und der daran angeschlossenen Komponente. Wenn das Problem nach Ausführen der Maßnahmen unter "Fehlerbehebung" weiterhin besteht, kann es möglicherweise behoben werden, indem das Gerät in den Auslieferungszustand zurückgesetzt wird. Zurücksetzen des Geräts (die werksseitigen Standardeinstellungen werden wiederhergestellt) 1. Während das Gerät eingeschaltet und keine Disc eingelegt ist, halten Sie g auf dem Hauptgerät gedrückt und drücken Sie DIRECT. 2. Auf der Anzeige erscheint die Meldung "CLEAR", das Gerät wird in den Standby-Modus geschaltet, und die Einstellungen werden zurückgesetzt. CLEAR ■ Stromversorgung Das Gerätlässt sich nicht einschalten • Ziehen Sie das Netzkabel aus der Steckdose, warten Sie mindestens 2 Minuten und stecken Sie es dann wieder ein. Das Gerät schaltet sich unerwartet ab • Das Gerät wird automatisch in den Standby-Modus geschaltet, wenn die Einstellung "AUTO STANDBY" im SETUP-Menü aktiviert ist. Die STANDBY-Anzeige am Hauptgerät blinkt weiterhin rot, und es sind keine Bedienvorgänge möglich • Ziehen Sie das Netzkabel aus der Steckdose, warten Sie mindestens 2 Minuten und stecken Sie es dann wieder ein. Drücken Sie trotz weiterhin blinkender Anzeige 8 STANDBY/ ON auf dem Hauptgerät, um die Netzstromversorgung einzuschalten (ON). Wenn das Problem damit nicht behoben ist, handelt es sich möglicherweise um einen Funktionsfehler. Entfernen Sie das Netzkabel aus der Steckdose und wenden sich an Ihren Händler oder unseren Kundendienst, um sich unterstützen zu lassen. ■ Das Display leuchtet nicht • Es ist möglich, dass das Display durch Drücken von DISPLAY OFF ausgeschaltet wurde. Drücken Sie DISPLAY OFF, um das Display einzuschalten. ■ Es können keine Discs wiedergegeben werden • Legen Sie die Disc mit der beschrifteten Seite nach oben in das Disc-Fach ein. • Es ist eventuell keine Wiedergabe möglich, wenn die Disc verkratzt oder verschmutzt ist. • Tondateien, die urheberrechtlich geschützt sind, können nicht abgespielt werden. • Das Disc-Fach öffnet sich, wenn Sie eine Disc einlegen, die dieses Gerät nicht unterstützt. ■ Audio Ton ist unterbrochen • Wird der Sperrbereich über die LOCK RANGE ADJUSTEinstellung zu stark verringert, kann es zu Wiedergabeunterbrechungen und Störgeräuschen kommen. Wiedergabeunterbrechungen durch Anpassungen des Sperrbereichs sind kein Garantiefall. Passen Sie den Sperrbereich während einer Audiowiedergabe an. Sorten oder alte und neue Batterien mischen. • Achten Sie darauf, dass das Gerät keinem direkten Sonnenlicht oder Invertertyp-Leuchtstofflampenlicht ausgesetzt wird. Ändern Sie den Standort, falls notwendig. • Wenn dieses Gerät in einem Gestell oder einem Gehäuse mit gefärbten Glastüren installiert ist und die Türen geschlossen sind, funktioniert die Fernbedienung möglicherweise nicht einwandfrei. ■ D/A-Wandlerfunktion • Vergewissern Sie sich, dass jede Videokomponente ordnungsgemäß angeschlossen ist. • Geben Sie Audiodaten wieder, die mit den Eingangsbuchsen dieses Geräts kompatibel sind. (P14) Es ist keine Audiowiedergabe vom Computer möglich • Deaktivieren Sie die Stummschaltfunktion am Computer. • Wählen Sie in den Audioausgabeeinstellungen des Computers dieses Gerät aus. Wenn die Quelle dieses Geräts eine andere Einstellung als “USB DAC” aufweist, wird das Gerät vom PC nicht erkannt. • Werden mehrere Anwendungen gleichzeitig auf dem Computer ausgeführt, schließen Sie die Anwendungen, die Sie nicht benötigen. Die Abtastfrequenz über den USB DAC-Eingang bleibt immer gleich • Je nach Einstellungen des Computers werden unterschiedliche Abtastfrequenzen verschiedener Dateien für die Ausgabe zur gleichen Abtastfrequenz umgewandelt. Es erfolgt keine digitale Klangausgabe • Stellen Sie "DIGITAL OUT" im SETUP-Menü auf "ON" ein. • Das Audio von SACD und DSD oder Eingabe von USB DAC ist keine digitale Ausgabe. Andere Computersounds als Musik werden über den USB DAC-Eingang empfangen • Je nach Einstellungen des Computers werden Computersounds wie der Ton beim Hochfahren oder Fehlertöne möglicherweise über dieses Gerät ausgegeben. ■ Fernbedienung ■ SACD • Stellen Sie sicher, dass die Batterien mit der richtigen Polarität eingelegt sind. • Legen Sie neue Batterien ein. Keine Batterien unterschiedlicher • Aufgrund unterschiedlicher Aufzeichnungsmethoden kann es zwischen der SACD- und der CD-Wiedergabe einen Lautstärkenunterschied geben. De 17 > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Weitere Hinweise ■ Discs, die wiedergegeben werden können MQA-CD SACD (Super-Audio-CD) (Nur 2-Kanal-Bereich) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Vorsichtsmaßnahmen bei der Wiedergabe • Es können Compact-Discs (CDs) mit einem der folgenden Logos auf der bedruckten Seite verwendet werden: Wiedergabe von Hybrid-SACDs Hybrid-SACDs bestehen aus zwei Schichten: der SACDSchicht und der CD-Schicht. Drücken Sie CD/SACD, um die Schicht auszuwählen, die Sie wiedergeben möchten. Wiedergabe von DualDisks Eine "DualDisk" enthält auf einer Seite Video- und Audiodaten nach dem DVD-Standard und auf der anderen Seite Audiodaten, die von einem CD-Player wiedergegeben werden können. Auf der Audioseite (d. h. nicht die DVD-Seite) ist eine Wiedergabe nicht immer möglich, da die Disc nicht den physikalischen Spezifikationen von Standard-CDs entspricht. Bedienvorgänge während der Wiedergabe Während der Wiedergabe von Discs mit Musikdaten kann die Direktsuche nicht verwendet werden. • Beachten Sie, dass einige CDs möglicherweise aufgrund ihrer Eigenschaften, von Kratzern, Verschmutzungen oder des Aufnahmestatus nicht wiedergegeben werden können. 18 Disc-Typen, die von diesem Gerät nicht wiedergegeben werden können Wiedergabe von MQA DVD-Video, DVD-Audio, CD-G, Video-CD, DTS-CD Dieses Gerät enthält die MQA (Master Quality Authenticated) Technology, die Wiedergabe von MQAAudiodateien und Streams erlaubt, wobei der Klang der originalen Master-Aufnahme bewahrt wird. Dieses Gerät ist ein CD-Player, der eine MQA-CD erkennen kann. Der eingebaute MQA-Decoder stellt das hochaufgelöste Signal, das im Studio gehört wird, wieder her und bestätigt es mit der Authentifikations-Signatur. Weitere Informationen finden Sie bei www.mqa.co.uk/customer/mqacd. ‘MQA’ oder ‘MQA.’ zeigt an, dass das Produkt einen MQAStream oder eine Datei decodiert und abspielt, und bezeichnet die Herkunft, um sicherzustellen, dass der Klang identisch mit dem des Quellmaterials ist. ‘MQA.’ zeigt an, dass eine MQA Studio-Datei abgespielt wird, die entweder im Studio vom Interpreten/Producer genehmigt oder vom Urheberrechtsinhaber authentifiziert wurde. Hinweise zu Discs • Achten Sie darauf, beim Öffnen/Schließen des DiscFachs Hand und Finger nicht einzuklemmen. • Verwenden Sie keine CDs mit außergewöhnlicher Form (z. B. Herzen oder Achtecke). Solche CDs können verkanten und zu Geräteschäden führen. • Einige Audio-CDs mit Kopierschutz genügen den offiziellen CDStandards nicht. Es handelt sich dabei um besondere CDs, die von diesem Gerät nicht wiedergegeben werden können. • Verwenden Sie keine CDs mit Klebebandrückständen, Leih-CDs mit sich ablösenden Etiketten oder CDs mit dekorativen Etiketten. Solche CDs können verkanten und zu Geräteschäden führen. • Belassen Sie Discs mit Etiketten, die mit Tintenstrahldruckern bedruckt wurden, nicht über längere Zeiträume im Gerät. Solche CDs können verkanten und zu Geräteschäden führen. ■ Reinigen des Players • In der Regel genügt es, den Player mit einem weichen Tuch abzuwischen. Tragen Sie bei hartnäckigen Verschmutzungen ein wenig in 5 bis 6 Teilen Wasser verdünnten Neutralreiniger auf ein weiches Tuch auf. Wringen Sie das Tuch sorgfältig aus, wischen Sie den Schmutz ab, und wischen Sie mit einem trockenen Tuch nach. • Beachten Sie, dass das Auftragen von Alkohol, Verdünner, Benzin oder Insektiziden auf den Player dazu führen kann, dass sich Beschriftungen und Beschichtungen ablösen. Vermeiden Sie außerdem, dass Gummi- oder Vinylprodukte längere Zeit in Kontakt mit dem Player geraten, da dies das Gehäuse beschädigen könnte. • Wenn Sie chemisch imprägnierte Wischtücher usw. verwenden, lesen Sie sich die Vorsichtshinweise zu den Produkten sorgfältig durch. • Wenn sich auf dem CD-Fach anhaftender Staub nur schwer entfernen lässt, bringen Sie ein Klebeband usw. auf, um den Staub zu entfernen. ■ Vorsichtsmaßnahmen beim Bewegen des Geräts Wenn das Gerät bewegt werden soll, entnehmen Sie die Disc und schließen das Disc-Fach. Drücken Sie danach 8 STANDBY/ON am Hauptgerät, warten Sie noch 10 Sekunden, nachdem die Anzeige [OFF] erloschen ist, und trennen Sie dann das Netzkabel ab. Wird das Gerät mit eingelegter Disc bewegt, kann dies zu Beschädigungen führen. ■ Kondensation Wenn dieses Gerät von einem kalten an einen warmen Ort gebracht oder die Umgebung rasch erwärmt wird, beispielsweise durch eine Heizung, so können sich im Gerät Wassertropfen bilden. Dies bezeichnet man als Kondensation. Es kann dabei nicht nur zu Fehlfunktionen, sondern auch zu Schäden am Gerät bzw. der eingelegten CD kommen. Es wird empfohlen, CDs aus dem Gerät zu entfernen, wenn das Gerät längere Zeit nicht verwendet wird. Wenn das Risiko besteht, dass es zu Kondensation gekommen ist, trennen Sie das Netzkabel ab und lassen das Gerät mindestens 3 Stunden lang bei Raumtemperatur stehen. > Vor dem Start > Teilenamen > Installation > Wiedergabe Erweiterte Einrichtung | Andere Allgemeine technische Daten ■ Analoger Audioausgang ■ Sonstiges Ausgangsnennleistungspegel und Impedanz • RCA OUT: 2,3 Vrms (1 kHz, 0 dB) / 100  Control-Eingang • Ø3,5 Minibuchse (Mono) Frequenzgang • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Control-Ausgang • Ø3,5 Minibuchse (Mono) Signal-/Rauschabstand • CD: 116 dB oder mehr (A-Gewichtung), SACD: 116 dB oder mehr (A-Gewichtung) ■ Allgemeine Daten THD+N • CD: 0,002 % oder weniger, SACD: 0,002 % oder weniger ■ Digital-Audio-Eingang USB DAC • Typ B, USB Audio-Klasse 1.0 ■ Digitaler Audioausgang Digitaler koaxialer Ausgang • RCA-Buchse, 0,5 Vp-p / 75  Stromversorgung • AC 220 - 230 V, 50/60 Hz Stromverbrauch • 43 W • 0,3 W (Im Standby-Modus) AUTO STANDBY • ON (20 min) / OFF Abmessungen (B  H  T) • 435 mm  138 mm  413 mm Gewicht • 13,1 kg Optischer koaxialer Ausgang • Optische Buchse, -14 - -21 dBm / 660 nm De 19 20 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige SUPER AUDIO CD PLAYER PD-50AE Gebruikers handleiding En Fr Es It De Nl Sv Vóór het Starten Veiligheidsinformatie ............................................................... 2 Wat zit er in de doos ............................................................... 3 Namen van de onderdelen Voorpaneel ............................................................................. 4 Achterpaneel .......................................................................... 5 Afstandsbediening .................................................................. 6 Display .................................................................................... 7 Installeren Verbindingen met een versterker ............................................ 8 Het netsnoer verbinden, enz. ................................................11 Afspelen Discs afspelen ...................................................................... 12 Dit toestel als D/A-converter gebruiken ................................ 14 Aanpassen van geluidskwaliteit ............................................ 15 Geavanceerde Setup Geavanceerde instellingen .................................................... 16 Overige Problemen oplossen ............................................................. 17 Overige opmerkingen ............................................................ 18 Algemene specificaties.......................................................... 19 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Veiligheidsinformatie Vóór het Starten WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR 'H]HOLFKWÀLWVPHWSLMOSXQWLQHHQJHOLMN]LMGLJHGULHKRHNGLHQWGH JHEUXLNHUHURSDWWHQWWHPDNHQGDWHUQLHWJHwVROHHUGH³JHYDDUOLMNH VSDQQLQJ´LQGHEHKXL]LQJYDQKHWWRHVWHOLVHQSHUVRQHQELMHHQ YHUNHHUGHEHKDQGHOLQJHHQHOHNWULVFKHVFKRNRS]RXGHQNXQQHQORSHQ +HWXLWURHSWHNHQLQHHQJHOLMN]LMGLJHGULHKRHNGLHQW GHJHEUXLNHUHURSDWWHQWWHPDNHQGDWHUEHODQJULMNH DDQZLM]LQJHQYRRUEHGLHQLQJHQRQGHUKRXG UHSDUDWLH LQGH ELMKHWWRHVWHOJHOHYHUGHJHEUXLNVDDQZLM]LQJDDQZH]LJ]LMQ 23*(/(7 20+(7*(9$$59225((1(/(.75,6&+(6+2&.7(9225.20(1 '(.6(/ 2)58* 1,(79(5:,-'(5(1$$1'(%,11(1=,-'(%(9,1'(1 =,&+*((1(/(0(17(1',('225'(*(%58,.(5.811(1%(',(1' :25'(1(1.(/'225*(.:$/,),&((5'3(5621((/7(%(',(1(1 :$$56&+8:,1* 20+(7*(9$$59225((1(/(.75,6&+(6+2&.7( 9225.20(1'(.6(/ 2)58* 1,(79(5:,-'(5(1$$1'( %,11(1=,-'(%(9,1'(1=,&+*((1(/(0(17(1',('225 '(*(%58,.(5.811(1%(',(1':25'(1(1.(/'225 *(.:$/,),&((5'3(5621((/7(%(',(1(1 'LWDSSDUDDWLVQLHWZDWHUGLFKW2PEUDQGRIHHQHOHNWULVFKHVFKRNWH YRRUNRPHQPDJXJHHQYRRUZHUSGDWYORHLVWRIEHYDWLQGHEXXUWYDQKHW DSSDUDDW]HWWHQ ELMYRRUEHHOGHHQEORHPHQYDDV RIKHWDSSDUDDWRSDQGHUH ZLM]HEORRWVWHOOHQDDQZDWHUGUXSSHOVRSVSDWWHQGZDWHUUHJHQRIYRFKW 2PEUDQGWHYRRUNRPHQPDJXJHHQRSHQYXXU ]RDOVHHQEUDQGHQGH NDDUV RSGHDSSDUDWXXU]HWWHQ *HEUXLNRIEHZDDUEDWWHULMHQQLHWLQGLUHFW]RQOLFKWRIRSHHQKHWH SODDWV]RDOVLQGHDXWRRIELMHHQNDFKHO%DWWHULMHQNXQQHQKLHUGRRU JDDQOHNNHQRYHUYHUKLWWHQH[SORGHUHQRILQEUDQGYOLHJHQ%RYHQGLHQ YHUPLQGHUWGLWGHOHYHQVGXXURISUHVWDWLHVYDQGHEDWWHULMHQ 2 %HUJNOHLQHRQGHUGHOHQRSEXLWHQKHWEHUHLNYDQNLQGHUHQHQSHXWHUV 5DDGSOHHJRQPLGGHOOLMNHHQDUWVLQGLHQNOHLQHRQGHUGHOHQSHURQJHOXN ZRUGHQLQJHVOLNW 'HJOHXYHQHQRSHQLQJHQLQGHEHKXL]LQJYDQKHWDSSDUDDW]LMQ DDQJHEUDFKWYRRUGHYHQWLODWLH]RGDWHHQEHWURXZEDUHZHUNLQJYDQKHW DSSDUDDWZRUGWYHUNUHJHQHQRYHUYHUKLWWLQJZRUGWYRRUNRPHQ2PEUDQGWH YRRUNRPHQPRHWXHUYRRU]RUJHQGDWGH]HRSHQLQJHQQRRLWJHEORNNHHUG ZRUGHQRIGDW]HDIJHGHNWZRUGHQGRRUYRRUZHUSHQ NUDQWHQWDIHONOHHG JRUGLMQHG RIGRRUJHEUXLNYDQKHWDSSDUDDWRSHHQGLNWDSLMWRIHHQEHG 5LVLFRRSH[SORVLHDOVGHEDWWHULMGRRUHHQYHUNHHUGW\SHYHUYDQJHQZRUGW ([SORVLHULVLFR$OVHHQEDWWHULMZHJJHJRRLGZRUGWLQHHQYXXURIHHQKHWH RYHQRIPHFKDQLVFKYHUEULM]HOGZRUGWRIDOVHULQJHVQHGHQZRUGW 9RRU]RUJVPDDWUHJHOHQ $OVXKHWDSSDUDDWLQHHQRPVORWHQUXLPWHRSVWHOW]RDOVHHQDXGLRNDVWMH RIERHNHQUHNPRHWXHURRNRSOHWWHQGDWHUYROGRHQGHYHQWLODWLHLV =RUJHUYRRUGDWHUPLQVWHQVFPUXLPWHRSHQEOLMIWDDQGHERYHQNDQW HQGH]LMNDQWHQHQFPDDQGHDFKWHUNDQW'HDFKWHUUDQGYDQHHQ SODQNRISODDWGLHERYHQKHWDSSDUDDWLVPRHWFPYHUZLMGHUG]LMQ YDQGHZDQGRIPXXU]RGDWHUHHQVRRUWVFKRRUVWHHQSLMSRSHQLQJLV ZDDUGRRUGHZDUPHOXFKWNDQRQWVQDSSHQ *HEUXLNVRPJHYLQJ 7HPSHUDWXXUHQYRFKWLJKHLGVJUDDGRSGHSODDWVYDQJHEUXLN&WRW & )WRW) PLQGHUGDQ5+ YHQWLODWLHRSHQLQJHQ QLHWDIJHGHNW =HWKHWDSSDUDDWQLHWRSHHQVOHFKWJHYHQWLOHHUGHSODDWVHQVWHOKHW DSSDUDDWRRNQLHWEORRWDDQKRJHYRFKWLJKHLGRIGLUHFW]RQOLFKW RIVWHUNH NXQVWPDWLJHYHUOLFKWLQJ %HODQJULMNHPHGHGHOLQJ +HWPRGHOQXPPHUHQKHWVHULHQXPPHUYDQGH]HXLWUXVWLQJVWDDQRSGH DFKWHUNDQWRIGHRQGHUNDQW1RWHHUGH]HQXPPHUVRSXZELMJHVORWHQ JDUDQWLHNDDUWHQEHZDDUGLHRSHHQYHLOLJHSODDWVYRRUWRHNRPVWLJH UDDGSOHJLQJ /(723 'HVWURRPVFKDNHODDURSGLWWRHVWHO]DOQLHWDOOHVWURRPYROOHGLJYDQKHW VWRSFRQWDFWDIVOXLWHQ$DQJH]LHQHUQDKHWXLWVFKDNHOHQYDQKHWDSSDUDDW QRJHHQNOHLQHKRHYHHOKHLGVWURRPEOLMIWORSHQPRHWXGHVWHNNHUXLW KHWVWRSFRQWDFWKDOHQRPKHWDSSDUDDWYROOHGLJYDQKHWOLFKWQHWORVWH NRSSHOHQ3ODDWVKHWDSSDUDDW]RGDQLJGDWGHVWHNNHULQHHQQRRGJHYDO JHPDNNHOLMNXLWKHWVWRSFRQWDFWNDQZRUGHQJHKDDOG2PEUDQGWH YRRUNRPHQPRHWXGHVWHNNHUXLWKHWVWRSFRQWDFWKDOHQZDQQHHUX KHWDSSDUDDWODQJHUHWLMGQLHWGHQNWWHJHEUXLNHQ ELMYZDQQHHUXRS YDNDQWLHJDDW 'LWDSSDUDDWLVEHVWHPGYRRUQRUPDDOKXLVKRXGHOLMNJHEUXLN,QGLHQ KHWDSSDUDDWYRRUDQGHUHGRHOHLQGHQRIRSDQGHUHSODDWVHQZRUGW JHEUXLNW ELMYRRUEHHOGODQJGXULJJHEUXLNLQHHQUHVWDXUDQWYRRU]DNHOLMNH GRHOHLQGHQRIJHEUXLNLQHHQDXWRRIERRW HQDOVJHYROJKLHUYDQGHIHFW ]RXUDNHQ]XOOHQGHUHSDUDWLHVLQUHNHQLQJJHEUDFKWZRUGHQRRNDOV KHWDSSDUDDWQRJLQGHJDUDQWLHSHULRGHLV 1HWVQRHUYRRU]LFKWLJ +DQWHHUKHWQHWVQRHUGRRUGHVWHNNHUYDVWWHQHPHQ7UHNGHVWHNNHU QLHWORVGRRUDDQKHWVQRHUWHWUHNNHQHQUDDNKHWQHWVQRHUQRRLWDDQ PHWQDWWHKDQGHQRPGDWKLHUGRRUNRUWVOXLWLQJRIHHQHOHNWULVFKVFKRN YHURRU]DDNWNDQZRUGHQ3ODDWVKHWWRHVWHOHHQPHXEHOVWXNHQ]QLHW RSKHWQHWVQRHUHQNOHPKHWVQRHUQLHWDI0DDNQRRLWNQRSHQLQKHW QHWVQRHUHQNQRRSKHWQLHWYDVWDDQDQGHUHVQRHUHQ'HQHWVQRHUHQ PRHWHQ]RJHOHJGZRUGHQGDWKHWQLHWZDDUVFKLMQOLMNLVGDWHURSJHORSHQ NDQZRUGHQ(HQEHVFKDGLJGQHWVQRHUNDQEUDQGRIHHQHOHNWULVFKH VFKRNYHURRU]DNHQ&RQWUROHHUKHWQHWVQRHU]RQXHQGDQ$OVX]LHW GDWKHWQHWVQRHUEHVFKDGLJGLVYUDDJXZGLFKWVWELM]LMQGHHUNHQGH VHUYLFHFHQWUXPRIXZYHUNRSHUGDQRPKHPWHYHUYDQJHQ /(723 'LWDSSDUDDWLVJHFODVVL¿FHHUGDOVHHQNODVVHODVHUSURGXFWRQGHUGH YHLOLJKHLGVQRUPHQYRRUODVHUSURGXFWHQ,(& KLASSE 1 LASERPRODUCT *HEUXLNHUVLQIRUPDWLHYRRUKHWYHU]DPHOHQHQYHU ZLMGHUHQYDQRXGHSURGXFWHQHQEDWWHULMHQ Symbool voor toestellen Symbolen voor batterijen Pb 'HV\PEROHQRSSURGXFWHQYHUSDNNLQJHQHQELMEHKRUHQGH GRFXPHQWHQJHYHQDDQGDWGHJHEUXLNWHHOHNWURQLVFKHSURGXFWHQ HQEDWWHULMHQQLHWPHWKHWJHZRQHKXLVKRXGHOLMNDIYDONXQQHQ ZRUGHQVDPHQJHYRHJG (UEHVWDDWHHQVSHFLDDOZHWWHOLMNYRRUJHVFKUHYHQYHU]DPHOV\VWHHP YRRUGHMXLVWHEHKDQGOLQJKHWRSQLHXZEUXLNEDDUPDNHQHQGH UHF\FODJHYDQJHEUXLNWHSURGXFWHQHQEDWWHULMHQ 'RRUHHQFRUUHFWHYHU]DPHOKDQGHOLQJ]RUJWXHUYRRUGDWKHW YHUZLMGHUGHSURGXFWHQRIEDWWHULMRSGHMXLVWHZLM]HZRUGW EHKDQGHOGRSQLHXZEUXLNEDDUZRUGWJHPDDNWZRUGWJHUHF\FOHHUG HQKHWQLHWVFKDGHOLMNLVYRRUGHJH]RQGKHLGHQKHWPLOLHX 9RRUYHUGHUHLQIRUPDWLHEHWUHႇHQGHGHMXLVWHEHKDQGOLQJKHW RSQLHXZEUXLNEDDUPDNHQHQGHUHF\FODJHYDQJHEUXLNWHSURGXFWHQ HQEDWWHULMHQNXQWXFRQWDFWRSQHPHQPHWGHSODDWVHOLMNHRYHUKHLG RIHHQYHUNRRSSXQW 'H]HV\PEROHQ]LMQHQNHOJHOGLJLQGHODQGHQYDQGHHXURSHVH XQLH ,QGLHQX]LFKLQHHQDQGHUGDQERYHQJHQRHPGHODQGHQEHYLQGW NXQWXFRQWDFWRSQHPHQPHWGHSODDWVHOLMNHRYHUKHLGYRRUPHHU LQIRUPDWLHRYHUGHMXLVWHYHUZLMGHULQJYDQKHWSURGXFW :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Wat zit er in de doos 1. 2. 3. 4. • 1 2 3 Hoofdtoestel (1) Afstandsbediening (RC-980C) (1), batterijen (AAA/R03) (2) Analoge Audiokabel (Voor testuitvoering) (1) Netsnoer (1) Gebruiksaanwijzing (dit document) (1) • Het netsnoer moet pas worden verbonden nadat alle andere kabels verbonden zijn. • Wij zijn niet aansprakelijk voor enige schade als gevolg van de verbinding van apparatuur die door andere bedrijven geproduceerd is. • Specificaties en uiterlijk zijn zonder voorafgaande kennisgeving onderhevig aan veranderingen. De hoofdstroom kan niet in- of uitgeschakeld worden met de afstandsbediening. Gebruik de knop 8 STANDBY/ON op het hoofdtoestel. 4 Nl 3 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Voorpaneel Namen van de onderdelen 1 6 2 3 7 8 9 1. 8 STANDBY/ON-knop/controlelampje: Schakelt de netspanning van het toestel aan en uit. Wanneer het toestel opgestart wordt, gaat het controlelampje in het midden van de knop blauw branden. 2. STANDBY-controlelampje: Brandt rood wanneer het toestel in de stand-by-modus staat. 3. Disc-lade: Plaats hier discs. Er kunnen ook 8-cm discs gebruikt worden. 4. ;-knop: Open of sluit de disc-lade. 5. Afspeelknoppen: u t : Ga terug naar het begin van het nummer dat afgespeeld wordt. Druk er opnieuw om naar het nummer ervoor te gaan. Houd deze toets ingedrukt om het nummer snel terug te spoelen. q/h : Afspelen of afspelen pauzeren. y i : Als er tijdens het afspelen op gedrukt wordt, gaat men naar het volgende nummer. Houd hem ingedrukt om het nummer verder te spoelen. g : Deze toets stopt afspelen. 4 4 5 bk bl 6. Afstandsbedieningssensor • Het signaalbereik van de afstandsbediening ligt binnen ongeveer 16'/5 m. met een hoek van 20° ten opzichte van de loodrechte as en van 30° aan beide zijden. 7. CD/SACD-knop/controlelampje: Schakelt tussen CD/SACD als bron. Wanneer een hybride SACD afgespeeld wordt, wordt de afgespeelde layer omgeschakeld als u tijdens het afspelen hierop drukt. (P18) Het controlelampje gaat blauw branden als SACD geselecteerd wordt. 8. DIRECT-knop/controlelampje: Schakelt de DIRECT-modus in en uit. (P15) Het controlelampje gaat blauw branden als de DIRECT-modus op ON staat. 9. Display (P7) 10.SOURCE-knop: Schakelt naar de af te spelen bron. 11. SETUP-knop: Geeft het SETUP-menu weer. (P16) > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Achterpaneel 1 2 3 4 5 1. ANALOG OUT-aansluiting: Gebruik bijvoorbeeld een analoge audiokabel om een geïntegreerde versterker aan te sluiten. 2. AC IN: Verbind het bijgeleverde netsnoer. 3. USB DAC-poort: Gebruik een USB-kabel (A-B type) om een computer te verbinden. 4. DIGITAL OUT OPTICAL/COAXIAL-aansluiting: Gebruik een digitale optische kabel of een digitale coaxiale kabel om bijvoorbeeld een geïntegreerde versterker te verbinden. 5. CONTROL IN/OUT-aansluiting: Door versterkers van het merk Pioneer en audioapparaten te verbinden, is een gecentraliseerde bediening mogelijk. U kunt de versterkers en de audio-apparaten bijvoorbeeld bedienen. Nl 5 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Afstandsbediening 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. ^ STANDBY/ON-knop: Als de netvoeding van het toestel ingeschakeld is, schakelt deze knop het toestel in of op de stand-by-modus. De hoofdstroom kan niet in- of uitgeschakeld worden met de afstandsbediening. 2. SHUFFLE-knop: Stelt willekeurig afspelen in. (P13) 3. REPEAT-knop: Stelt herhaald afspelen in. (P13) 4. Genummerde knoppen: Gebruikt om het tracknummer van een muziek-CD rechtstreeks in te voeren wanneer tracks geselecteerd worden. Wordt ook gebruikt om tracknummers in te voeren voor programma afspelen. 5. CLEAR-knop: Wist de inhoud die ingesteld is voor programma afspelen. (P13) 6. DIGITAL FILTER-knop: Selecteert een van de drie soorten DIGITAL FILTER. (P15) 7. Cursorknoppen, ENTER-knop: Selecteer het item met de cursorknoppen en druk op ENTER om te bevestigen. 8. SETUP-knop: Geeft het SETUP-menu weer. (P16) 9. Afspeelknoppen: u : Terugkeer naar het begin van het nummer dat afgespeeld wordt. Druk er opnieuw om naar het nummer ervoor te gaan. /h : Afspelen of afspelen pauzeren. i : Ga naar het volgende nummer. t : Indrukken en ingedrukt houden om de track die afgespeeld wordt snel terug te spoelen. g : Stop afspelen. y : Indrukken en ingedrukt houden om de track die afgespeeld wordt snel vooruit te spoelen. 10.SOURCE-knop Schakelt naar de af te spelen bron. 11.DIRECT-knop: Schakelt de DIRECT-modus in en uit. (P15) 12.DISPLAY-knop: Verandert de informatie op het display. • Afhankelijk van de bron zou de bediening mogelijk niet van start gaan. 13.; OPEN/CLOSE-knop: Opent of sluit de disc-lade. 14.PROGRAM-knop: Gebruikt voor programma afspelen. (P13) 15.LOCK RANGE-knop: Geeft het instellingenscherm van LOCK RANGE ADJUST weer. (P15) 16.RETURN-knop: Zet het display terug naar de vorige toestand. 17.UP SAMPLING-knop: Zet de UP SAMPLING-functie ON en OFF. (P15) 18.CD/SACD-knop: Schakelt tussen CD/SACD als bron. Wanneer een hybride SACD afgespeeld wordt, wordt de afgespeelde layer omgeschakeld als u tijdens het afspelen hierop drukt. (P18) 19.DIGITAL OUT-knop: Schakelt de digitale uitgang op ON en OFF. (P16) 20.DISPLAY OFF-knop: Druk erop om het display van dit toestel uit te schakelen. Druk er opnieuw op om het display in te schakelen. 21.DIMMER-knop: U kunt de helderheid van het display regelen in drie stappen. (Standaardwaarde: Niveau 3) Laat de polen met elkaar samenvallen bij het plaatsen van de batterijen. > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Display 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Brandt tijdens het afspelen van SACD en DSD. 2. Berichtendisplay: Geeft informatie weer over nummers en menu's. 3. Brandt wanneer handelingen met de cursorknoppen van de afstandsbediening mogelijk zijn. 4. Toont de afspeelstatus. 5. Brandt wanneer de instelling van de digitale audio-uitgang ingeschakeld is. (P16) 6. Brandt wanneer items getoond worden zoals de resterende tijd voor een track van de disc of de totale tijd van de disc. 7. Display wanneer een MQA-bestand of stream wordt afgespeeld. Raadpleeg "MQA afspelen" voor meer informatie. (P18) Nl 7 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Verbindingen met een versterker Installeren Dit toestel 1 a 2 1 a 2 a Geïntegreerde versterker, AV-ontvanger, enz. Speel de audio af van discs die op dit toestel afgespeeld worden en van apparaten die met dit toestel verbonden zijn via luidsprekersystemen die verbonden zijn met geïntegreerde versterkers of AV-ontvangers. Maak de verbinding die past bij de ingangsaansluitingen op uw versterker. 8 a Analoge audiokabel Verbinden met een analoge audiokabel Het signaal wordt in de D/A-converter van dit toestel in analoog omgezet en vervolgens naar bijvoorbeeld een geïntegreerde versterker gezonden. Verbind de LINE INaansluitingen op een geïntegreerde versterker met de ANALOG OUT-aansluiting (RCA-aansluiting) op dit toestel. > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Verbinden met een digitale optische kabel Verbinden met een digitale coaxiale kabel Het signaal wordt in de D/A-converter van de geïntegreerde versterker in analoog omgezet bijvoorbeeld. Verbind de OPTICAL IN-aansluiting van een geïntegreerde versterker aan de DIGITAL OUT OPTICAL-aansluiting op dit toestel. • Het geluid van SACD en DSD of de invoer van USB DAC wordt niet uitgevoerd vanaf de DIGITAL OUT OPTICALaansluiting van dit toestel. Het signaal wordt in de D/A-converter van de geïntegreerde versterker in analoog omgezet bijvoorbeeld. Verbind de COAXIAL IN-aansluiting van een geïntegreerde versterker aan de DIGITAL OUT COAXIAL-aansluiting op dit toestel. • Het geluid van SACD en DSD of de invoer van USB DAC wordt niet uitgevoerd vanaf de DIGITAL OUT COAXIALaansluiting van dit toestel. • De digitale signalen die door dit toestel uitgezonden kunnen worden, zijn lineaire PCM-signalen met een bemonsteringsfrequentie en een quantisatie bit-rate van 192 kHz/24 bit (de werking is misschien niet mogelijk met alle verbonden apparaten of omgevingen). • De digitale signalen die door dit toestel uitgezonden kunnen worden, zijn lineaire PCM-signalen met een bemonsteringsfrequentie en een quantisatie bit-rate van 192 kHz/24 bit (de werking is misschien niet mogelijk met alle verbonden apparaten of omgevingen). Nl 9 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige De bedieniningsaansluiting Als u apparaten van meerdere Pioneer merken heeft en als deze CONTROL IN/OUT aansluitingen hebben, kunt u deze centraal besturen door middel van de afstandsbedieningsensor op de versterker bijvoorbeeld. Door verbinding te maken met de mono ministekkerkabels (zonder resistors) zoals afgebeeld in het diagram, kunt u zelfs als dit toestel en andere apparaten op plaatsen gezet worden waar deze het afstandsbedieningsignaal niet kunnen ontvangen, nog steeds de afstandsbedieningsensor gebruiken om dit toestel of andere apparaten mee te bedienen door de afstandsbediening te richten op de afstandsbediening op de versterker bijvoorbeeld. • Wees er tevens zeker van dat de verbinding met de analoge audiokabel gemaakt wordt. De gecentraliseerde bediening werkt mogelijk niet correct met alleen de verbinding van de bedieningsaansluiting. • De afstandsbedieningsensor op dit toestel stopt met werken als u een mono ministekkerkabel (zonder weerstand) met de CONTROL IN-aansluiting van dit toestel verbindt. • De afstandsbedieningsensoren op de andere apparaten stoppen met werken als u een mono ministekkerkabel (zonder weerstand) met de CONTROL OUT-aansluiting van dit toestel verbindt. • Als er een Pioneer merk-netwerk-speler en -versterker verbonden wordt door de CONTROL IN/OUT-aansluiting, kunt u basishandelingen uitvoeren op dit toestel, de netwerkspeler en versterker op een smartphone app over een netwerk. 10 (Een voorbeeld van verbinding) IN OUT CONTROL a Versterker a Dit toestel IN OUT CONTROL Audioapparaat a Mono ministekkerkabels (zonder weerstanden) > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Het netsnoer verbinden, enz. 1 Verbinding netsnoer 2 a a a Netsnoer Dit model bevat een verwijderbaar netsnoer. Het netsnoer moet pas worden aangesloten nadat alle andere aansluitingen zijn voltooid. Zorg ervoor het netsnoer eerst aan te sluiten op de AC IN-aansluiting van het toestel en vervolgens op het stopcontact. Koppel altijd eerst de kant van het stopcontact los wanneer u het netsnoer ontkoppelt. Opstarten Druk op het hoofdtoestel op 8 STANDBY/ON. • Druk tijdens het opstarten erop, tot de knop naar binnen gaat. Bij het opstarten van het toestel gaat het 8 STANDBY/ON-controlelampje in het midden van de knop blauw branden. Nl 11 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Discs afspelen Afspelen 1 Raadpleeg (P18) voor discs die u op dit toestel kunt afspelen. Muziek-CD's afspelen Voer de volgende procedure uit terwijl het toestel ingeschakeld is. 1. Druk op de afstandsbediening op CD/SACD om de bron op CD/SACD te zetten. 2. Druk op het hoofdtoestel op ; om de disc-lade te openen en druk, nadat de disc in de lade gelegd is, opnieuw op ; om de lade te sluiten. 3. Druk op de afstandsbediening op /h (g) om het afspelen te starten. 4. Gebruik afspeelknoppen (h) om het afspelen te stoppen of nummers om af te spelen te kiezen. U kunt de selectie ook uitvoeren door het tracknummer in te voeren met de nummerknoppen (b). Als een tracknummer van 2 cijfers ingevoerd wordt, druk dan net zo vaak op de +10-knop als de waarde van het tweede cijfer (tienden) en druk vervolgens de waarde van het eerste cijfer in. Als u op DISPLAY (d) drukt, kunt u het display inschakelen om de verstreken tijd of de resterende tijd van de disc te tonen, enz. • De weergegeven inhoud is afhankelijk van de disc. • De weergave van de tracknaam wordt alleen ondersteund met de formaten muziekbestanden MP3/ WMA/FLAC/AAC (alleen M4A)/DSD (alleen DSF). • De tekens die niet op dit toestel weergegeven kunnen worden, worden weergegeven als asterisken "". a e b c f Een disc met muziekbestanden afspelen 2 12 Voer de volgende procedure uit terwijl het toestel ingeschakeld is. 1. Druk op de afstandsbediening op CD/SACD om de bron op CD/SACD te zetten. 2. Druk op het hoofdtoestel op ; om de disc-lade te openen en druk, nadat de disc in de lade gelegd is, opnieuw op ; om de lade te sluiten. 3. Druk op de afstandsbediening op /h (g) om het afspelen te starten. 4. Gebruik afspeelknoppen (h) om het afspelen te stoppen of nummers om af te spelen te kiezen. Als u op DISPLAY (d) drukt, kunt u het display inschakelen om de verstreken tijd of de resterende tijd van de disc te tonen, de bestandsnaam van de track of de tracknaam, enz. • De weergegeven inhoud is afhankelijk van de disc en het bestand. g h d > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Herhaald afspelen Specificaties van bestanden die afgespeeld kunnen worden 1. Druk herhaaldelijk op REPEAT (a) tijdens afspelen om of 1 op het display weer te geven. ALL : Herhaald afspelen van alle tracks. 1 : Herhaald afspelen van de track die afgespeeld wordt. Om herhaald afspelen te annuleren, druk meerdere keren op REPEAT (a) om OFF op het display weer te geven. ALL Willekeurig afspelen 1. Druk op SHUFFLE (f) tijdens het afspelen of stoppen om op het display weer te geven. : Willekeurig afspelen van alle tracks. Om gemengd afspelen te annuleren, druk op SHUFFLE (f) om OFF op het display weer te geven. Bemonsteringsfrequentie MP3 WMA AAC WAV AIFF Programma afspelen FLAC U kunt de volgorde selecteren waarmee tracks op een muziek-CD afgespeeld worden. 1. Druk op PROGRAM (e) terwijl gestopt is. "P00" wordt weergegeven als niets geregistreerd is. Voer met de nummerknoppen (b) het tracknummer in dat u wilt registreren. Als een tracknummer van 2 cijfers ingevoerd wordt, druk dan net zo vaak op de +10-knop als de waarde van het tweede cijfer (tienden) en druk vervolgens de waarde van het eerste cijfer in. Het nummer in "P00" neemt iedere keer dat u een track registreert toe. Er kunnen maximaal 24 tracks geprogrammeerd worden. • Druk op /h (g) op de afstandsbediening om het geregistreerde programma af te spelen. • Als u op CLEAR (c) drukt terwijl tracks geregistreerd worden, worden de tracks in volgorde gewist, te beginnen met de track die het laatst geregistreerd werd. • Als u op PROGRAM (e) drukt terwijl tracks geregistreerd worden, worden alle tracks die u geregistreerd heeft gewist. • Als de totale speelduur van het geregistreerde programma langer is dan 99 minuten 59 seconden, wordt " : " op het display weer te geven. ALAC Bitsnelheden Tussen 8 kbps en 320 kbps en VBR. Tussen 5 kbps en 44,1/48 kHz 192 kbps en VBR. Tussen 8 kbps en 44,1/48/88,2/96 kHz 320 kbps en VBR. 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48 kHz Kwantiseringsbit Soorten discs die afgespeeld kunnen worden CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW Extensie – .mp3 – .wma – * .aac/ .m4a 8/16/24 bit * .wav 8/16/24 bit * .aif/ .aiff 8/16/24 bit * .flac 8/16/24 bit * .m4a .dsf/ .dff 44,1/48/88,2/96/176,4/ .flac/ * MQA – 8/16/24 bit 192/352,8/384 kHz .wav * Bij het afspelen van bestanden die groter zijn dan 48 kHz moeten bestanden gebruikt worden die op een DVD-disc opgenomen zijn. Opmerkingen over alle soorten bestanden • Gebruik CD/CD-R/CD-RW discs die in overeenstemming zijn met de standaard ISO9660 niveau 1/niveau 2 bestandssysteem voor CD-ROM en die opgenomen zijn met gebruik van het systeem conform uitgebreide formattering (Joliet en Romeo). Als DVD-discs gebruikt worden, gebruik dan naast bovenstaande discs de discs die opgenomen zijn met gebruik van het UDF-bestandssysteem. • De mapstructuur is beperkt tot acht niveaus en het maximum aantal tracks is 3000. Afhankelijk van de mapstructuur kan het echter zijn dat niet alle mappen en tracks herkend en afgespeeld kunnen worden. DSD 2,8/5,6 MHz – 1 bit – Opmerkingen over specifieke soorten bestanden • Codeer WMA-bestanden met applicaties die gecertificeerd zijn door de Microsoft Corporation van de Verenigde Staten. De werking kan mogelijk niet correct zijn als u niet-gecertificeerde applicaties gebruikt. • Dit toestel ondersteunt het afspelen van AAC-bestanden met de extensie ".m4a" die gecodeerd zijn met gebruik van iTunes. Het kan echter zijn dat afspelen niet mogelijk is als het bestand beveiligd is met DRM kopieerbeveiliging (bescherming van het auteursrecht) of met bepaalde versies van iTunes die voor het coderen gebruikt werden. • WAV-bestanden bevatten ongecomprimeerde PCM digitale audio. • AIFF-bestanden bevatten ongecomprimeerde PCM digitale audio. Nl 13 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Dit toestel als D/A-converter gebruiken U kunt de digitale audio van de PC op dit toestel naar analoog converteren en vervolgens uitvoeren vanaf de ANALOG OUT-aansluitingen. 1 Naar de bron schakelen 1. Druk op SOURCE van dit toestel of de afstandsbediening om de bron van het apparaat te schakelen naar “USB DAC”. USB DAC 2 Aansluitingen 2. Gebruik een USB-kabel type A-B om een computer te verbinden. Afspelen a 14 a USB-kabel 3. Start het afspelen op de speler. • De digitale signalen die door dit toestel uitgezonden kunnen worden, zijn lineaire PCM-signalen met een bemonsteringsfrequentie en een quantisatie bit-rate van 48 kHz/32 bit (de werking is misschien niet mogelijk met alle verbonden apparaten of omgevingen). • De ondersteunde besturingssystemen van de PC zijn Windows10® en Mac OS X. • Bij andere besturingssystemen dan de ondersteunde, kan het geluid worden onderbroken of niet worden weergegeven. • Afhankelijk van de gebruiksomgeving wordt het afspelen mogelijk niet normaal uitgevoerd. > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Aanpassen van geluidskwaliteit Reproduceert getrouw het oorspronkelijke geluid (DIRECT-modus) Processen die van invloed op de geluidskwaliteit zijn worden afgesloten waardoor een geluid geproduceerd wordt dat zich dichter bij het originele geluid bevindt. (Standaardwaarde): OFF 1. Druk op DIRECT (d). • Het DIRECT-controlelampje op de voorkant van het hoofdtoestel brandt terwijl de DIRECT-modus ON is. • Als de DIRECT-modus ON is, is DIGITAL OUT op OFF gezet. • In de DIRECT-modus, wordt het display automatisch uitgeschakeld tijdens het afspelen van CD of SACD, of wanneer USB DAC is verbonden. • Wanneer u tijdens het afspelen van instelling verandert, kan het geluid worden onderbroken. UP SAMPLING De vergroting van de bemonsteringsfrequentie helpt om een geluidsweergave met een hoge mate van helderheid te verkrijgen. (Standaardwaarde) : OFF 1. U kunt ook drukken op UP SAMPLING (g) om de functie ON en OFF te zetten. • Deze functie kan niet worden gebruikt wanneer de DIRECT-modus is ingesteld op ON of tijdens het afspelen van SACD of DSD. • De instelling is vastgesteld op "ON" tijdens het afspelen van MQA-CD of een schijf die muziekbestanden bevat of bij gebruik van USB DAC. • Wanneer u tijdens het afspelen van instelling verandert, kan het geluid worden onderbroken. DIGITAL FILTER De lock range aanpassen (LOCK RANGE ADJUST) Selecteert een van de drie soorten DIGITAL FILTER. 1. De instelling verandert iedere keer wanneer u op DIGITAL FILTER (a) drukt. "SLOW": Zacht en vloeibaar geluid "SHARP" (Standaardwaarde): Geluid met meer structuur en stevigheid "SHORT": Geluid dat snel begint en vooruit lijkt te bewegen • U kunt ook op SETUP (c) drukken om het instellingenscherm voor DIGITAL FILTER weer te geven van uit het SETUP-menu. Selecteer de waarde van de instelling in dit geval met / (b) op de afstandsbediening. • De instelling is vastgesteld op “SHORT” tijdens het afspelen van MQA-CD of een schijf die muziekbestanden bevat of bij gebruik van USB DAC. • Wanneer u tijdens het afspelen van instelling verandert, kan het geluid worden onderbroken. De geluidskwaliteit wordt verbeterd door de lock range te versmallen zodat er minder incidentele geluiden zullen zijn. Als de lock range echter te smal wordt kunnen onderbrekingen van het geluid en ruis veroorzaakt worden. Pas de lock range aan terwijl u naar het geluid luistert. (Standaardwaarde): RANGE 6 1. Druk op LOCK RANGE (e). 2. Selecteer de instellingswaarde met / (f) op de afstandsbediening. "RANGE 6" (breed) tot "RANGE 1" (smal) • U kunt ook op SETUP (c) drukken om het instellingenscherm voor LOCK RANGE ADJUST weer te geven van uit het SETUP-menu. • De instelling is vastgesteld op "6" tijdens het afspelen van MQA-CD of een schijf die muziekbestanden bevat of bij gebruik van USB DAC. • LOCK RANGE ADJUST is niet van invloed op de audio van SACD en DSD. • Wanneer u tijdens het afspelen van instelling verandert, kan het geluid worden onderbroken. a e b f c d g Nl 15 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Geavanceerde instellingen Geavanceerde Setup 1 AUTO STANDBY LOCK RANGE ADJUST Deze instelling zet de unit automatisch op stand-by na 20 minuten inactiviteit zonder audio-invoer. "ON" (Standaardwaarde): Het toestel zal automatisch naar de stand-by-modus gaan. "OFF": Het toestel zal niet automatisch naar de stand-bymodus gaan. De lock range aanpassen. (P15) POWER ON PLAY Het toestel stelt u in staat geavanceerde instellingen te configureren om u een nog betere ervaring te laten beleven. 1. Druk op de afstandsbediening op SETUP. U kunt het zo instellen dat de disc automatisch begint af te spelen wanneer dit toestel ingeschakeld wordt. • Door een extern verbonden automatische timer te gebruiken, kunt u afspelen volgens de timer wanneer de stroom automatisch ingeschakeld wordt. "ON": Om discs automatisch af te spelen "OFF" (Standaardwaarde): Als geen disc afgespeeld moeten worden AUTO STANDBY 2. Selecteer de inhoud of de instelling met de cursorknoppen op de afstandsbediening en druk op ENTER om uw selectie te bevestigen. Om terug te keren naar het vorige scherm, druk op RETURN. DIGITAL OUT Maak instellingen voor digitale audio-uitgave. Als geen verbinding gemaakt wordt met de DIGITAL OUT OPTICAL/ COAXIAL-aansluiting, kunt u naar nog helderder audio luisteren door dit op OFF te zetten. "ON" (Standaardwaarde), "OFF" DIGITAL FILTER U kunt het type DIGITAL FILTER selecteren. (P15) UP SAMPLING 3. Druk op SETUP om de instellingen te verlaten. 16 De vergroting van de bemonsteringsfrequentie helpt om een geluidsweergave met een hoge mate van helderheid te verkrijgen. (P15) LOADING MODE De laadtijd voor een CD kan worden ingekort. • Door deze functie te activeren, kan de laadtijd worden verkort, afhankelijk van de CD, het geluid kan echter overslaan aan het begin van het afspelen. "NORMAL" (Standaardwaarde): Wanneer de laadtijd voor CD niet is ingekort "FAST": Wanneer de laadtijd voor de CD is ingekort > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Problemen oplossen Overige Alvorens de procedure te starten Wanneer bediening onstabiel is, kunnen problemen opgelost worden door simpelweg de stroom aan te zetten of op stand-by te zetten of het netsnoer eruit/erin te doen, i.p.v. instellingen en bedieningen na te kijken. Probeer de eenvoudige maatregelen op zowel de unit als het aangesloten apparaat. Als het probleem niet opgelost wordt na raadpleging van "Problemen oplossen", kan het probleem verholpen worden door het toestel te resetten naar de status die het had op het moment van verzending. Het resetten van het toestel (hierdoor worden de instellingen van het toestel op de standaardwaarden gereset) 1. Met ingeschakelde stroom en terwijl geen disc geplaatst is, houd u op het hoofdtoestel g ingedrukt en drukt u op DIRECT. 2. "CLEAR" wordt weergegeven, het toestel schakelt naar stand-by en de instellingen worden gereset. CLEAR ■ Voeding Kan het toestel niet inschakelen • Trek de stekker van het netsnoer uit het stopcontact, wacht 2 minuten of langer en steek de stekker weer in het stopcontact. Het apparaat schakelt onverwachts uit • Het toestel schakelt automatisch naar stand-by als de instelling "AUTO STANDBY" in het SETUP-menu werkt. Het STANDBY-controlelampje op het hoofdtoestel gaat door met rood knipperen en de bediening is niet mogelijk • Trek de stekker van het netsnoer uit het stopcontact, wacht 2 minuten of langer en steek de stekker weer in het stopcontact. het controlelampje blijft knipperen maar druk op het hoofdtoestel op 8 STANDBY/ON om de netstroom op ON te zetten. Als dit het probleem niet verhelpt, kan het om een storing gaan. Trek de stekker uit het stopcontact en neem contact op met de verkoper of onze klantendienst. ■ Het display wordt niet verlicht • Het is mogelijk dat het display uitgeschakeld werd toen op DISPLAY OFF gedrukt werd. Druk op DISPLAY OFF om het display in te schakelen. ■ Kan geen discs afspelen • Plaats de disc zo in de laden dat het etiket naar boven wijst. • Afpelen zou niet mogelijk kunnen zijn als de disc krassen heeft of vuil is. • Geluidsbestanden die worden beschermd door het auteursrecht kunnen niet worden afgespeeld. • De disclade gaat open als u een disc plaatst die niet door dit toestel ondersteund wordt. ■ Audio Geluid wordt onderbroken • Als de lock range te smal wordt met de instelling van LOCK RANGE ADJUST kunnen onderbrekingen van het geluid en kan ook ruis veroorzaakt worden. Onderbrekingen van het geluid die veroorzaakt worden door aanpassingen van de lock range worden niet door onze garantie van de werking gedekt. Luister ergens naar terwijl u de lock range aanpast. Er is geen digitaal geluid • Zet "DIGITAL OUT" in het SETUP-menu op "ON". • Het geluid van SACD en DSD of de invoer van USB DAC is geen digitale uitvoer. ■ Afstandsbediening • Zorg ervoor dat de batterijen met de polen in de juiste richting zijn geplaatst. • Plaats nieuwe batterijen. Gebruik geen verschillende soorten batterijen of nieuwe en oude batterijen door elkaar. • Zorg ervoor dat dit toestel niet wordt blootgesteld aan direct zonlicht of TL-verlichting van het type inverter. Verplaats indien nodig. • Als dit toestel is geïnstalleerd in een rek of kast met gekleurde glazen deuren, of als de deuren gesloten zijn, zal de afstandsbediening mogelijk niet goed werken. ■ D/A-converterfunctie • Controleer of de apparaten correct verbonden zijn. • Speel audio af die compatibel is met de ingangsaansluitingen op dit toestel. (P14) Kan geen audio afkomstig van computers afspelen • Annuleer de geluidsdemping op uw computer. • Selecteer dit toestel in de instellingen voor het uitzenden van audio op uw computer. Als de bron van dit apparaat op iets anders staat dan “USB DAC”, kan de PC dit apparaat niet detecteren. • Als er meerdere applicaties op de computer werkzaam zijn, sluit dan de applicaties af die u niet gebruikt. De bemonsteringsfrequentie is altijd dezelfde via de USB DAC-ingang • Afhankelijk van de computerinstellingen en zelfs als de bemonsteringsfrequenties van de afgespeelde bestanden verschillend zijn, worden ze geconverteerd in dezelfde bemonsteringsfrequentie om uitgezonden te worden. Computergeluiden anders dan muziek worden via de USB DAC-ingang uitgezonden. • Afhankelijk van de instellingen op de computer worden geluiden zoals de opstarttoon of foutgeluiden via dit toestel afgespeeld. ■ SACD • Wegens de verschillende opnamemethoden kan er verschil in volume zijn tussen SACD en CD. Nl 17 > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Overige opmerkingen ■ Discs die afgespeeld kunnen worden MQA-CD SACD (Super Audio CD) (alleen 2-kanaalszone) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Voorzorgsmaatregelen voor het afspelen • Er kunnen compact discs (CD's) met het volgende logo op het etiket gebruikt worden. Afspelen van hybride SACD Hybride SACD's bestaan uit twee layers; de SACD-layer en de CD-layer. Druk op CD/SACD om de layer te selecteren waarnaar u wilt luisteren. DualDisks afspelen "DualDisk" is een disc waarvan op de ene zijde de video en de audio voldoen aan de DVD-standaard en op de andere zijde de audio op een CD-speler kan worden afgespeeld. Op de audiozijde die niet de DVD-zijde is, is afspelen misschien niet altijd mogelijk wegens het feit dat de disc niet in overeenstemming is met de fysieke specificaties van standaard-CD's. Bediening tijdens het afspelen Rechtstreeks zoeken werkt niet tijdens het afspelen van dics met muziekgegevens. • Houd er rekening mee dat sommige discs mogelijk niet kunnen worden afgespeeld wegens de kenmerken van de disc, krassen, vuil of de opnamestatus. Disctypen die niet op dit toestel afgespeeld kunnen worden MQA afspelen Opmerkingen over discs Dit toestel omvat de MQA (Master Quality Authenticated) technologie voor het afspelen van MQA audiobestanden en streams, waarbij het geluid van de originele masteropname wordt geleverd. Dit apparaat is een CD-speler die een MQA-CD kan herkennen. De ingebouwde MQA-decoder herstelt het hogeresolutiesignaal dat in de studio wordt gehoord en bevestigt dit met behulp van de authenticatiesignatuur. Bezoek www.mqa.co.uk/customer/mqacd voor meer informatie. ‘MQA’ of ‘MQA.’ geeft aan dat het product een MQA-stream of -bestand decodeert en afspeelt om ervoor te zorgen dat het geluid identiek is aan dat van het bronmateriaal. ‘MQA.’ geeft aan dat het een MQA Studio-bestand afspeelt, dat ofwel in de studio is goedgekeurd door de kunstenaar/producent ofwel is geverifieerd door de eigenaar van het auteursrecht. 18 DVD Video, DVD Audio, CD-G, Video CD, DTS-CD • Pas op dat uw hand of uw vingers niet vast komen te zitten wanneer de disklade geopend of gesloten wordt. • Gebruik nooit discs die een ongebruikelijke vorm hebben (zoals hartvormige of achthoekige discs). Deze soorten discs kunnen vastlopen en het toestel schade berokkenen. • Sommige audio-CD's met een kopieerbeveiligingsfunctie komen niet overeen met de officiële normen voor CD's. Dit zijn speciale discs en kunnen niet door dit toestel worden afgespeeld. • Gebruik geen discs met resten cellofaan erop, gehuurde discs met afgebladderde etiketten of discs met decoratieve etiketten. Dit type disc kan vast komen te zitten in het toestel of kan het toestel schade berokkenen. • Laat een disc met een etiket dat door een inkjet printer afgedrukt is nooit lange tijd in het toestel zitten. De disc kan vast komen te zitten in het toestel of kan het toestel schade berokkenen. ■ Reinigen van de speler • Gewoonlijk hoeft u de speler slechts schoon te vegen met een zachte doek. Hardnekkig vuil kunt u weg poetsen met een zachte doek met wat neutrale zeep in 5 tot 6 delen water, stevig uitgewrongen, om daarna zorgvuldig na te drogen met een zachte droge doek. • Gebruik geen spiritus, thinner, benzeen of insecticide op de speler, want dergelijke middelen kunnen de afwerking aantasten. Laat ook niet langdurig plastic of rubber voorwerpen tegen de speler aan liggen, want ook dat kan de afwerking aantasten. • Bij gebruik van een chemisch reinigingsdoekje e.d. dient u de gebruiksaanwijzing daarvan zorgvuldig te lezen. • Wanneer stof op de schijflade moeilijk te verwijderen is, breng dan plakband, enz. aan om het stof te verwijderen. ■ Voorzorgsmaatregelen bij het verplaatsen van het toestel Als het toestel verplaatst wordt, verwijder dan eerst iedere disc die erin zit en sluit de disc-lade. Druk vervolgens op het hoofdtoestel op 8 STANDBY/ON, wacht 10 seconden nadat [OFF] van het display verdwenen is en trek vervolgens de stekker van het netsnoer uit het stopcontact. Als het toestel verplaatst wordt terwijl er nog steeds een disc in zit, kan dit schade veroorzaken. ■ Condensvorming Er kunnen waterdruppels binnenin het toestel ontstaan als het van een koude plaats naar een warme ruimte meegenomen wordt of als een koude ruimte snel verwarmd wordt door een verwarming. Dit wordt condens genoemd. Dit kan niet alleen een slechte werking van het toestel veroorzaken maar ook de disc of onderdelen van het toestel schade berokkenen. Wij raden aan de discs uit het toestel te halen als het toestel een poosje niet gebruikt zal worden. Als de mogelijkheid bestaat dat condens opgetreden is, trek het netsnoer dan los en laat het toestel minstens 3 uur op kamertemperatuur. > Vóór het Starten > Namen van de onderdelen > Installeren > Afspelen Geavanceerde Setup | Overige Algemene specificaties ■ Analoge audio-uitgang ■ Overige Nominaal uitgangsniveau en impedantie • RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100  Ingaande bediening • Ø3,5 mini-aansluiting (mono) Frequentie reactie • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Uitgaande bediening • Ø3,5 mini-aansluiting (mono) Signaal/ruis-verhouding • CD: 116 dB of meer (A-weging), SACD: 116 dB of meer (A-weging) ■ Algemeen THD+N • CD: 0,002 % of minder, SACD: 0,002 % of minder ■ Digitale audio-ingang USB DAC • Type B, USB Audioklasse 1.0 ■ Digitale audio-uitgang Coaxiale digitale uitgang • RCA-aansluiting, 0,5 Vp-p / 75  Voeding • AC 220 - 230 V, 50/60 Hz Stroomverbruik • 43 W • 0,3 W (In Stand-by) AUTO STANDBY • ON (20 min) / OFF Afmetingen (B  D  H) • 435 mm  138 mm  413 mm Gewicht • 13,1 kg Optische digitale uitgang • Optische aansluiting, -14 - -21 dBm / 660 nm Nl 19 20 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt SUPER AUDIO CD PLAYER PD-50AE Grundläggande bruksanvisning En Fr Es It De Nl Sv Innan du börjar Säkerhetsinformation .............................................................. 2 Vad som finns i förpackningen ................................................ 3 Delarnas namn Frontpanel .............................................................................. 4 Bakpanel ................................................................................. 5 Fjärrkontroll ............................................................................. 6 Display .................................................................................... 7 Installera Anslutningar till en förstärkare ................................................ 8 Att ansluta nätkabeln, etc. .....................................................11 Uppspelning Spela upp skivor ................................................................... 12 Att använda den här apparaten som en D/A-omvandlare ..........14 Att justera ljudkvaliteten ........................................................ 15 Avancerade inställningar Avancerade inställningar ....................................................... 16 Övrigt Felsökning ............................................................................ 17 Andra anmärkningar: ............................................................. 18 Allmänna specifikationer........................................................ 19 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Säkerhetsinformation Innan du börjar WARNING RISK OF ELECTRIC SHOCK DO NOT OPEN AVIS RISQUE DE CHOC ELECTRIQUE NE PAS OUVRIR %OL[WSLOHQLQRPHQOLNVLGLJWULDQJHOlUDYVHGGDWWYDUQD DQYlQGDUHQRPDWWGHW¿QQVRLVROHUDG³IDUOLJVSlQQLQJ´LQXWL DSSDUDWHQVRPNDQYDUDWLOOUlFNOLJWVWDUNI|UDWWJHHOHNWULVND VW|WDUPHGSHUVRQVNDGRUVRPI|OMG 8WURSVWHFNQHWLQRPHQOLNVLGLJWULDQJHOlUDYVHGGDWWSnPLQQD DQYlQGDUHQRPDWWGHW¿QQVYLNWLJDDQYlQGQLQJVRFK XQGHUKnOOVDQYLVQLQJDULOLWWHUDWXUHQVRPPHGI|OMHUDSSDUDWHQ 2%6(59(5$ $9/b*61$,17(+g/-(7 (//(5%$.6,'$1 'c'(7),1165,6. )g5(/(.75,6.67g7'(7),116,1*$'(/$5620.$16(59$6 $9$19b1'$5(1,187,(1+(7(1g9(5/c76(59,&(7,//%(+g5,* 6(59,&(3(5621$/ 9$51,1* $9/b*61$,17(+g/-(7 (//(5%$.6,'$1 'c'(7),116 5,6.)g5(/(.75,6.67g7'(7),116,1*$'(/$5620.$1 6(59$6$9$19b1'$5(1,187,(1+(7(1g9(5/c76(59,&( 7,//%(+g5,*6(59,&(3(5621$/ 'HQQDXWUXVWQLQJlULQWHYDWWHQWlW3ODFHUDGlUI|ULQWHQnJRQEHKnOODUH PHGYlWVNDLQlUKHWHQDYXWUXVWQLQJHQ VRPWH[HQYDVHOOHU EORPNUXND 8WVlWWLQWHKHOOHUXWUXVWQLQJHQI|UGURSSDQGHVNYlWWDQGH UHJQHOOHUIXNWGnGHW¿QQVULVNI|UEUDQGRFKHOVW|W 3ODFHUDLQJD|SSQDOnJRU VRPWH[HWWWlQWOMXV SnXWUXVWQLQJHQGnGHW ¿QQVULVNI|UEUDQG $QYlQGLQWHHOOHUI|UYDUDLQWHEDWWHULHULGLUHNWVROOMXVHOOHUSnDQGUD |YHUGULYHWYDUPDSODWVHUVnVRPLQXWLHQELOHOOHULQlUKHWHQDYHQ YlUPDUH'HWWDNDQOHGDWLOODWWEDWWHULHUQDOlFNHU|YHUKHWWDVH[SORGHUDU HOOHUE|UMDUEULQQD'HWNDQlYHQPLQVNDEDWWHULHUQDVOLYVOlQJGHOOHU SUHVWDQGD )|UYDUDVPnGHODUXWRPUlFNKnOOI|UEDUQ2PGHVYlOMVDYPLVVWDJ PnVWHHQOlNDUHJHQDVWXSSV|NDV 'HW¿QQVOXFNRURFK|SSQLQJDUI|UYHQWLODWLRQLSURGXNWHQVK|OMHI|UDWW JDUDQWHUDWLOOI|UOLWOLJGULIWRFKI|UDWWI|UKLQGUD|YHUKHWWQLQJgSSQLQJDUQD E|UDOGULJEORFNHUDVHOOHUWlFNDVDYI|UHPnO H[HPSHOYLVWLGQLQJDU ERUGVGXNDUJDUGLQHU GnGHWWD|NDUEUDQGULVNHQ3URGXNWHQE|ULQWH KHOOHUDQYlQGDVSnHQWMRFNPDWWDHOOHULHQVlQJ 2PEDWWHULHWE\WVXWPRWHWWDYIHOW\S¿QQVGHWHQULVNI|UH[SORVLRQ'HW ¿QQVHQULVNI|UH[SORVLRQRPHWWEDWWHULERUWVNDႇDVLHOGHOOHUHQKHW XJQHOOHUNURVVDVPHNDQLVNWHOOHURPEDWWHULHWVNlUVXSS 2 )|UVLNWLJKHWVnWJlUGHU 2PDSSDUDWHQSODFHUDVLHQP|EHOWLOOH[HPSHOLHQERNK\OODHOOHULHQ VWHUHRElQNVnVHWLOODWWWLOOUlFNOLJYHQWLODWLRQWLOOJRGRVHV 6HWLOODWWOlPQDHWWXWU\PPHSnPLQVWFPRYDQI|URFKSnVLGRUQDDY DSSDUDWHQRFKSnPLQVWFPEDNRPDSSDUDWHQ'HQEDNUHNDQWHQSn K\OODQHOOHUVNLYDQRYDQI|UDSSDUDWHQE|UYDUDSODFHUDGPLQVWFP IUnQDSSDUDWHQVEDNVLGDHOOHUYlJJHQI|UDWWVNDSDHWWPHOODQUXPJHQRP YLONHWYDUPOXIWNDQVWU|PPDXW 'ULIWVPLOM| 'ULIWVPLOM|QVWHPSHUDWXURFKOXIWIXNWLJKHW&WLOO& )WLOO ) PLQGUHlQUHODWLYOXIWIXNWLJKHW OXIWLQWDJHMEORFNHUDGH ,QVWDOOHUDLQWHHQKHWHQLHWWGnOLJWYHQWLOHUDWXWU\PPHHOOHUSnSODWVHU VRPXWVlWWVI|UK|JOXIWIXNWLJKHWHOOHUGLUHNWVROOMXV HOOHUVWDUNDUWL¿FLHOO EHO\VQLQJ 9LNWLJWPHGGHODQGH 0RGHOORFKVHULHQXPUHWSnGHQKlUXWUXVWQLQJHQVLWWHUEDNWLOOHOOHU XQGHUWLOO1RWHUDGHVVDQXPPHUSnGHWPHGI|OMDQGHJDUDQWLNRUWHWRFK I|UYDUDGHWSnHQVlNHUSODWVI|UIUDPWLGDEUXN 9$5)g56,.7,* 6WU|PEU\WDUNQDSSHQSnGHQKlUDSSDUDWHQNRPPHULQWHDWWVWlQJD DYDOOVWU|PIUnQYlJJXWWDJHWKHOW(IWHUVRPQlWNDEHOQDQYlQGVVRP KXYXGVDNOLJIUnQVNLOMDUHI|UGHQQDHQKHWNRPPHUGXEHK|YDNRSSODERUW QlWNDEHOQIUnQYlJJXWWDJHWI|UDWWVWlQJDDYDOOVWU|P'lUI|UPnVWHGX VHWLOODWWHQKHWHQKDULQVWDOOHUDWVVnDWWQlWNDEHOQOlWWNDQNRSSODVERUW IUnQYlJJXWWDJHWYLGRO\FNRU)|UDWWXQGYLNDEUDQGULVNE|UQlWNDEHOQ GHVVXWRPNRSSODVERUWIUnQYlJJXWWDJHWQlUHQKHWHQOlPQDVRDQYlQG XQGHUHQOnQJWLG WLOOH[HPSHOQlUGXlUERUWDSnVHPHVWHU 'HQQDSURGXNWlUWLOOI|UDOOPlQQDKXVKnOOVlQGDPnO(YHQWXHOODIHOVRP XSSVWnUSnJUXQGDYDQQDQDQYlQGQLQJ VRPWH[OnQJWLGVDQYlQGQLQJ LNRPPHUVLHOOWV\IWHLHQUHVWDXUDQJHOOHUDQYlQGQLQJLHQELOHOOHUSnHQ EnW RFKVRPPnVWHUHSDUHUDVGHELWHUDVlYHQXQGHUJDUDQWLSHULRGHQ )|UVLNWLJKHWPHGHONDEHOQ +DQWHUDQlWNDEHOQPHGKMlOSDYVWLFNNRQWDNWHQ'UDLQWHXWNRQWDNWHQ JHQRPDWWU\FNDLNDEHOQRFKU|UDOGULJQlWNDEHOQQlUGLQDKlQGHUlU YnWDHIWHUVRPGHWWDVNXOOHNXQQDOHGDWLOONRUWVOXWQLQJHOOHUHOHNWULVNVW|W 3ODFHUDLQWHHQKHWHQHQGHODYHQP|EHOHWFSnQlWNDEHOQRFKQ\S LQWHWLOONDEHOQ*|UDOGULJHQNQXWSnNDEHOQRFKELQGLQWHLKRSGHQPHG DQGUDNDEODU1lWNDEODUQDE|UOlJJDVVnDWWGHWLQWHlUWUROLJWDWWQnJRQ JnUSnGHP(QVNDGDGQlWNDEHONDQOHGDWLOOEUDQGHOOHUJHGLJHQ HOHNWULVNVW|W.RQWUROOHUDQlWNDEHOQPHGMlPQDPHOODQUXP1lUGXVHU DWWGHQlUVNDGDGVNDGXEHYnUWQlUPDVWHDXNWRULVHUDGHVHUYLFHFHQWHU HOOHUGLQnWHUI|UVlOMDUHDWWE\WDXWGHQ 9$5)g56,.7,* 'HQKlUSURGXNWHQlUNODVVDGVRPNODVVODVHUSURGXNWXQGHU/DVHU 6lNHUKHW,(& KLASS 1-LASERPRODUKT ,QIRUPDWLRQWLOODQYlQGDUHDYVHHQGHLQVDPOLQJRFK KDQWHULQJDYXWWMlQWXWUXVWQLQJRFKI|UEUXNDGH EDWWHULHU Symbol produkter Symbol batterier Pb 1lUGHQQDV\PERO¿QQVSnSURGXNWHUI|USDFNQLQJDURFKHOOHU PHGI|OMDQGHGRNXPHQWLQQHElUGHWWDDWWI|UEUXNDGHOHNWULVNRFK HOHNWURQLVNXWUXVWQLQJRFKEDWWHULHULQWHInUEODQGDVPHGYDQOLJW KXVKnOOVDYIDOO )|UEHK|ULJEHKDQGOLQJnWHUYLQQLQJRFKnWHUDQYlQGQLQJDYXWWMlQWD SURGXNWHURFKI|UEUXNDGHEDWWHULHUYlQOLJHQOlPQDGHVVDSnKlUI|U DYVHGGDXSSVDPOLQJVSODWVHULHQOLJKHWPHGQDWLRQHOOODJVWLIWQLQJ *HQRPDWWDYIDOOVKDQWHUDGHVVDSURGXNWHURFKEDWWHULHUSnHWW NRUUHNWVlWWELGUDUGXWLOODWWVN\GGDYlUGHIXOODUHVXUVHURFK I|UKLQGUDIUDPWLGDSRWHQWLHOODQHJDWLYDHႇHNWHUSnPlQQLVNRUV KlOVDRFKYnUPLOM|YLONDLDQQDWIDOONDQNRPPDDWW|NDWLOOI|OMGDY RWLOOE|UOLJDYIDOOVKDQWHULQJ )|UPHULQIRUPDWLRQRPLQVDPOLQJRFKnWHUYLQQLQJDYXWWMlQWD SURGXNWHURFKEDWWHULHUYlQOLJHQNRQWDNWDGLQNRPPXQORNDO DYIDOOVLQVDPOLQJHOOHUGHQEXWLNGlUGXN|SWSURGXNWHUQD 'HVVDV\PEROHUlUHQGDVWJLOWLJDLQRP(XURSHLVND8QLRQHQ :((( KWWSZZZRQN\RFRPPDQXDOZHHHZHHHSGI > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Vad som finns i förpackningen 1. 2. 3. 4. • 1 2 3 Huvudapparat (1) Fjärrkontroll (RC-980C) (1), Batterier (AAA/R03) (2) Analog Ljudkabel (För testoperation) (1) Nätkabel (1) Bruksanvisning (det här dokumentet) (1) • Nätkabeln får inte anslutas innan alla andra kabelanslutningar har slutförts. • Vi kommer inte att ta något ansvar för skador som uppstår på grund av anslutning av utrustning som tillverkats av andra företag. • Specifikationer och utseende kan ändras utan föregående meddelande. Det går inte att sätta på eller stänga av huvudströmmen med fjärrkontrollen. Använd 8 STANDBY/ON-knappen på huvudapparaten. 4 Sv 3 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Frontpanel Delarnas namn 1 6 2 3 7 8 9 1. 8 STANDBY/ON-knapp/indikator: Sätter på och stänger av huvudströmmen till apparaten. När apparaten startas, lyser indikatorn i mitten av knappen blått. 2. STANDBY-indikator: Lyser rött när apparaten är i standbyläget. 3. Skivfack: Placera skivan här. Det går även att använda 8 cm-skivor. 4. ;-knappen: Öppnar eller stänger skivfacket. 5. Spela-knappen: u t : Går tillbaka till början av det spår som spelas. Tryck på den igen för att gå tillbaka till föregående spår. Tryck och håll ned för att spola tillbaka spåret snabbt. q/h : Spela eller pausa uppspelningen. y i : Går till nästa spår, om du trycker på den under uppspelning. Tryck och håll kvar för att snabbspola genom spåret. g : Den här knappen stoppar uppspelningen. 6. Fjärrkontrollsensor • Fjärrkontrollens mottagningsområde är inom ett avstånd på ungefär 16´/5 m och en vinkel på 20° i vertikal riktning och 30° till höger och vänster. 4 4 5 bk bl 7. CD/SACD-knapp/indikator: Växla mellan cd/sacd som källa. När man spelar upp en hybrid-sacd, ändras lagret som spelas om du trycker på denna vid uppspelning. (P18) Indikatorlampan lyser blått när du valt sacd. 8. DIRECT-knapp/indikator: Växlar DIRECT-läget mellan av och på. (P15) Indikatorn lyser blått när DIRECT-läget är ON. 9. Display (P7) 10.SOURCE-knappen: Ändrar vilken källa som ska spelas. 11. SETUP-knappen: Visar SETUP-menyn. (P16) > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Bakpanel 1 2 3 4 5 1. ANALOG OUT-uttag: Använd en analog audiokabel för att ansluta en integrerad förstärkare, t.ex. 2. AC IN: Anslut den medföljande nätkabeln. 3. USB DAC-port: Använd en usb-kabel (A-B typ) för att ansluta till en dator. 4. DIGITAL OUT OPTICAL/COAXIAL-uttag: Använda en digital optisk kabel eller en digital koaxialkabel för att t.ex. ansluta en integrerad förstärkare. 5. CONTROL IN/OUT-uttag: Om du ansluter förstärkare och ljudenheter av märket Pioneer är centraliserad styrning möjlig. Till exempel kan du styra förstärkarna och ljudenheterna. Sv 5 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Fjärrkontroll 1 2 3 bn bo 4 5 6 bp 7 8 bq 9 bk bl bm 6 br bs bt ck cl 1. ^ STANDBY/ON-knapp: När huvudströmmen till apparaten är på, sätter den här på apparaten eller sätter den i standbyläge. Det går inte att sätta på eller stänga av huvudströmmen med fjärrkontrollen. 2. SHUFFLE-knappen: Ställer in blandad uppspelning. (P13) 3. REPEAT-knappen: Ställer in upprepad uppspelning. (P13) 4. Sifferknappar: Använd dessa för att direkt skriva in spårnummer på en musik-cd när du väljer spår. Används också för att skriva in spårnummer vid programmerad uppspelning. 5. CLEAR-knappen: Radera innehållet som ställts in för programmerad uppspelning. (P13) 6. DIGITAL FILTER-knappen: Välj en av de tre typerna DIGITAL FILTER. (P15) 7. Markörknappar, ENTER-knapp: Välj alternativet med markörknapparna och tryck på ENTER för att bekräfta. 8. SETUP-knappen: Visar SETUP-menyn. (P16) 9. Spela-knappen: u : Går tillbaka till början av det spår som spelas. Tryck på den igen för att gå tillbaka till föregående spår. /h : Spela eller pausa uppspelningen. i : Gå till nästa spår. t : Tryck och håll kvar för att snabbspola bakåt genom spåret medan det spelas. g : Stoppa uppspelningen. y : Tryck och håll kvar för att snabbspola framåt genom spåret medan det spelas. 10.SOURCE-knappen: Ändrar vilken källa som ska spelas. 11.DIRECT-knappen: Växlar DIRECT-läget mellan av och på. (P15) 12.DISPLAY-knappen: Växlar informationen på displayen. • Beroende på källan, kanske funktionen inte startar. 13.; OPEN/CLOSE-knappen: Öppnar eller stänger skivfacket. 14.PROGRAM-knappen: Används för programmerad uppspelning. (P13) 15.LOCK RANGE-knappen: Visar LOCK RANGE ADJUSTinställningsskärmen. (P15) 16.RETURN-knappen: Tryck för att gå tillbaka till den föregående inställningen. 17.UP SAMPLING-knapp: Slå ON (på) och OFF (av) UP SAMPLING -funktionen. (P15) 18.CD/SACD-knapp: Växla mellan cd/sacd som källa. När man spelar upp en hybrid-sacd, ändras lagret som spelas om du trycker på denna vid uppspelning. (P18) 19.DIGITAL OUT-knappen: Växlar den digitala utgången mellan av och på. (P16) 20.DISPLAY OFF-knappen: Tryck på den för att stänga av displayen på den här apparaten. Tryck på den igen för att sätta på displayen. 21.DIMMER-knappen: Du kan justera displayens ljusstyrka i tre steg. (Standardvärde: nivå 3) När du sätter i batterierna ska du se till att polariteten matchar. > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Display 1 2 3 4 5 DIGITAL DSD 6 TOTAL REMAIN 7 1. Tänds vid uppspelning av sacd och DSD. 2. Meddelandedisplay: Visar information om spår och menyer. 3. Tänds när det går att använda markörknapparna på fjärrkontrollen. 4. Visar uppspelningsstatus. 5. Tänds när den digitala ljudutgångsinställningen är på. (P16) 6. Tänds när alternativ som kvarvarande tid för ett spår eller en skiva, eller den totala tiden för skivan visas. 7. Display när en MQA-fil eller -ström spelas. För detaljer, se "Spela MQA". (P18) Sv 7 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Anslutningar till en förstärkare Installera Den här enheten 1 a 2 1 a a 2 Integrerad förstärkare, AV-receiver, etc. Spela ljudet från skivor som spelas upp på den här apparaten och från enheter som är anslutna till den här apparaten genom högtalarsystem anslutna till integrerade förstärkare eller AV-mottagare. Anslut så att de passa ingångsuttagen på din förstärkare. 8 a Analog ljudkabel Ansluta med en analog ljudkabel Signalen konverteras till analog i den här apparatens D/Aomvandlare och skickas sedan t.ex. ut till den integrerade förstärkaren. Anslut LINE IN-uttagen på den integrerade förstärkaren till den här apparatens ANALOG OUT-uttag (RCA-uttag). > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Ansluta med en digital optisk kabel Ansluta med en digital koaxialkabel Signalen konverteras till analog i den integrerade förstärkarens D/A-omvandlare t.ex. Anslut OPTICAL INuttaget på en integrerad förstärkare till DIGITAL OUT OPTICAL-uttaget i denna enhet. • Audio från sacd och DSD eller input från USB DAC matas inte ut från DIGITAL OUT OPTICAL-uttaget på denna enhet. Signalen konverteras till analog i den integrerade förstärkarens D/A-omvandlare t.ex. Anslut COAXIAL INuttaget i en integrerad förstärkare till DIGITAL OUT COAXIAL-uttaget i denna enhet. • Audio från sacd och DSD eller input från USB DAC matas inte ut från DIGITAL OUT COAXIAL-uttaget på denna enhet. • De digitala signalerna som kan matas ut av den här apparaten är linjära PCM-signaler med en samplingsfrekvens och kvantiseringsbithastighet på 192 kHz/24 bitar (det kanske inte fungerar med alla anslutna enheter eller i alla miljöer). • De digitala signalerna som kan matas ut av den här apparaten är linjära PCM-signaler med en samplingsfrekvens och kvantiseringsbithastighet på 192 kHz/24 bitar (det kanske inte fungerar med alla anslutna enheter eller i alla miljöer). Sv 9 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Styruttaget Om du har flera enheter av märket Pioneer och om de har CONTROL IN/OUT-uttag, kan du kontrollera dem centralt via förstärkarens fjärrkontrollsensor, till exempel. Genom att ansluta med mono-miniplugkablar utan resistorer (se diagram), kan du använda fjärrkontrollen för att styra den här och andra enheter, även om de befinner sig på platser där de inte kan ta emot fjärrkontrollens signal, genom att rikta fjärrkontrollen mot förstärkarens fjärrkontrollsensor till exempel. • Se också till att ansluta med den analoga ljudkabeln. Centraliserad styrning fungerar inte korrekt om du endast använder styruttagsanslutningen. • Fjärrkontrollsensorn på denna enhet slutar fungera om du ansluter en mono-miniplugkabel (utan resistor) till CONTROL IN uttaget på denna enhet. • Fjärrkontrollsensorerna på övriga enheter slutar fungera om du ansluter en mono-miniplugkabel (utan resistor) till CONTROL OUT -uttaget på denna enhet. • Om en nätverksspelare och förstärkare av märket Pioneer ansluts via CONTROL IN/OUT-uttaget kan du styra grundfunktionerna på denna enhet, nätverksspelaren och förstärkaren med en smartphoneapp över ett nätverk. (Ett exempel på anslutning) IN OUT CONTROL a Förstärkare a Den här enheten IN OUT CONTROL Ljudenhet a Monominikontaktkablar (utan resistorer) 10 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Att ansluta nätkabeln, etc. 1 Anslutning av nätkabeln 2 a a a Nätkabel Denna modell har en löstagbar nätkabel. Nätkabeln får inte anslutas innan alla andra anslutningar är slutförda. Se till att du först ansluter nätkabeln till AC INuttaget på apparaten och anslut den sedan till ett eluttag. Koppla alltid loss nätkabeln från vägguttaget först när kabeln ska kopplas loss. Starta Tryck på 8 STANDBY/ON på huvudenheten. • När du ska starta apparaten, trycker du tills knappen går in. När apparaten startar, lyser 8 STANDBY/ONindikatorn i mitten av knappen blått. Sv 11 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Spela upp skivor Uppspelning 1 Se (P18) för info om skivor du kan spela på den här apparaten. Spela musik-cd:ar Utför följande procedur när apparaten är på. 1. Tryck på CD/SACD på fjärrkontrollen för att ställa in källan på cd/sacd. 2. Tryck på ; på huvudapparaten för att öppna skivfacket, och efter att skivan satts i facket, trycker du på ; igen för att stänga facket. 3. Tryck på /h (g) på fjärrkontrollen för att starta uppspelningen. 4. Använd uppspelningsknapparna (h) för att stoppa uppspelningen eller för att välja spår att spela upp. Du kan också välja genom att skriva in spårnumret med sifferknapparna (b). När du skriver in ett 2-siffrigt spårnummer, trycker du på +10-knappen lika många gånger som värdet på den andra siffran (tiotal), och sedan trycker du in värdet för den första siffran. Om du trycker på DISPLAY (d), kan du växla visningen mellan att visa förfluten tid eller kvarvarande tid av skivan etc. • Vilket innehåll som visas beror på skivan. 2 12 • Visning av spårets namn stöds för endast för musikfiler i formaten MP3/WMA/FLAC/AAC (endast M4A)/DSD (endast DSF). • Tecken som inte kan visas på den här apparaten visas som "". a e b c f Spela en skiva med musikfiler Utför följande procedur när apparaten är på. 1. Tryck på CD/SACD på fjärrkontrollen för att ställa in källan på cd/sacd. 2. Tryck på ; på huvudapparaten för att öppna skivfacket, och efter att skivan satts i facket, trycker du på ; igen för att stänga facket. 3. Tryck på /h (g) på fjärrkontrollen för att starta uppspelningen. 4. Använd uppspelningsknapparna (h) för att stoppa uppspelningen eller för att välja spår att spela upp. Om du trycker på DISPLAY (d), kan du växla visningen mellan att visa förfluten tid, kvarvarande tid på skivan, spårets filnamn eller spårets namn, etc. • Vilket innehåll som visas beror på skivan och filen. g h d > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Upprepad uppspelning 1. Tryck på REPEAT (a) flera gånger under uppspelning för att visa ALL eller 1 på displayen. ALL : Upprepa uppspelningen av alla spår. 1 : Upprepa uppspelningen av spåret som spelas. För att avbryta repeterad avspelning, tryck på REPEAT (a) ett flertal gånger för att visa OFF på displayen. Specifikationer på filer som kan spelas upp Samplingsfrekvenser MP3 WMA Blandad uppspelning 1. Tryck på SHUFFLE (f) under avspelning eller stopp för att visa på displayen. : Spelar upp alla spår slumpmässigt. För att avbryta slumpmässig avspelning, tryck på SHUFFLE (f) för att visa OFF på displayen. AAC WAV AIFF FLAC Programmerad uppspelning Du kan välja vilken ordning spåren på en musik-cd spelas upp i. 1. Tryck på PROGRAM (e) när den stoppats. "P00” visas när det inte registrerats något. Skriv spårnumret du vill registrera med sifferknapparna (b). När du skriver in ett 2-siffrigt spårnummer, trycker du på +10-knappen lika många gånger som värdet på den andra siffran (tiotal), och sedan trycker du in värdet för den första siffran. Spårnumret i "P00" ökar varje gång du registrerar ett spår. Det går att registrera upp till 24 spår. • Tryck på /h (g) på fjärrkontrollen för att spela upp det registrerade programmet. • Om du trycker på CLEAR (c) medan du registrerar spår, raderas spåren i ordning, med början från det spår du registrerade senast. • Om du trycker på PROGRAM (e) medan du registrerar spår, raderas alla spår du registrerat. • Om den totala avspelningstiden för det registrerade programmet överstiger 99 minuter och 59 sekunder, så visas " : " på displayen. ALAC DSD Bithastigheter Mellan 8 kbit/s och 320 kbit/s och VBR. Mellan 5 kbit/s och 44,1/48 kHz 192 kbit/s och VBR. Mellan 8 kbit/s och 44,1/48/88,2/96 kHz 320 kbit/s och VBR. 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48/88,2/96/ – 176,4/192 kHz 44,1/48 kHz 2,8/5,6 MHz – Kvantiseringsbit Typer av skivor som kan spelas upp CD-R/ DVD-R/ DVD+R/ CD-RW DVD-RW DVD+RW Filändelse – .mp3 – .wma – * .aac/ .m4a 8/16/24 bitar * .wav 8/16/24 bitar * .aif/ .aiff 8/16/24 bitar * .flac 8/16/24 bitar * .m4a 1 bitar – .dsf/ .dff .flac/ .wav 44,1/48/88,2/96/176,4/ * – 8/16/24 bitar 192/352,8/384 kHz * Använd filer som spelats in på en dvd-skiva när filer som överskrider 48 kHz spelas upp. Anmärkningar om alla filtyper • Använd cd/cd-r/cd-rw-skivor som följer standarden ISO9660 nivå 1/nivå 2 på cd-rom-filsystemet och som är inspelad med systemet som överensstämmer med utökad formatering (Romeo och Julia). När du använder dvd-skivor ska du, förutom ovanstående, använda skivor som spelats in med filsystemet UDF. • Mappstrukturen är begränsad till åtta nivåer och det maximala antalet spår är 3000. Men, beroende på mappstrukturen, kanske det inte går att hitta och spela alla mappar och spår. MQA Anmärkningar om särskilda filtyper • Koda WMA-filer med hjälp av program som certifierats av Microsoft Corporation i USA. Funktionerna kanske inte fungerar som de ska om du använder program som inte certifierats. • Den här apparaten stöder uppspelning av AAC-filer med filändelsen ".m4a" som har kodats med iTunes. Men det kanske inte går att spela upp den om filen skyddats med kopieringsskyddet DRM (upphovsrättsskydd) eller när vissa versioner av iTunes använts vid kodningen. • WAV-filer innehåller okomprimerat PCM digitalt ljud. • AIFF-filer innehåller okomprimerat digitalt PCM-ljud. Sv 13 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Att använda den här apparaten som en D/A-omvandlare Du kan konvertera digital audio från datorn till analog på denna enhet och sedan mata ut den från ANALOG OUTuttaget. 1 Ändra källa 1. Tryck på SOURCE på denna enhet eller på fjärrkontrollen för att skifta källan på enheten till “USB DAC”. USB DAC 2 Anslutningar 2. Använd en usb-kabel av A-B typ för att ansluta till en dator. Uppspelning a 14 a usb-kabel 3. Starta uppspelning från spelaren. • De digitala signalerna som kan matas in i den här apparaten är linjära PCM-signaler med en samplingsfrekvens och kvantiseringsbithastighet på 48 kHz/32 bitar (det kanske inte fungerar med alla anslutna enheter eller i alla miljöer). • Operativsystem som stöds i dator för anslutning är Windows10® och Mac OS X. • Med andra operativsystem kan ljudet avbrytas eller inte matas ut alls. • Beroende på omgivningen kan det hända att avspelning inte kan utföras normalt. > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Att justera ljudkvaliteten Att återge det ursprungliga ljudet verklighetstroget (DIRECT-läge) Bearbetning som påverkar ljudkvaliteten stängs av så att ljudet som återges är närmare originalet. (Standardvärde): OFF 1. Tryck på DIRECT (d). • DIRECT-Indikatorn på framsidan av huvudapparaten tänds när DIRECT-läget är ON. • När DIRECT-läget är ON, ställs DIGITAL OUT in på OFF. • I DIRECT-läge, så slocknar displayen automatiskt när man spelar cd eller sacd, eller ansluter USB DAC. • När man skiftar inställningen under avspelning kan det hända att audio avbryts. DIGITAL FILTER Välj en av de tre typerna DIGITAL FILTER. 1. Inställningen ändras varje gång du trycker på DIGITAL FILTER (a). "SLOW": Mjukt och flytande ljud "SHARP" (Standardvärde): Ljud med mer struktur och fasthet "SHORT": Ljud som startar snabbt och verkar röra sig framåt • Du kan också trycka på SETUP (c) för att visa DIGITAL FILTER-inställningsskärmen via SETUP-menyn. I så fall väljer du värdet som ska ställas in med / (b) på fjärrkontrollen. • Inställningen är fixerad till "SHORT" när man spelar MQA-CD eller en skiva med musikfiler, eller använder USB DAC. • När man skiftar inställningen under avspelning kan det hända att audio avbryts. UP SAMPLING Att utöka samplingsfrekvensen gör att det blir lättare att återge ljud med högre klarhet. (Standardvärde) : OFF 1. Du kan även trycka på UP SAMPLING (g) för att slå ON (på) och OFF (av) funktionen. • Denna funktion kan inte användas när DIRECT-läget är ON (på) eller under avspelning av sacd eller DSD. • Inställningen är fixerad till "ON" när man spelar MQA-CD eller en skiva med musikfiler, eller använder USB DAC. • När man skiftar inställningen under avspelning kan det hända att audio avbryts. Justera låsomfånget (LOCK RANGE ADJUST) Ljudkvaliteten förbättras genom att begränsa låsomfånget så att oförutsedda ljud minskas. Men om man begränsar låsomfånget för mycket, kan det orsaka avbrott i ljudet och brus. Justera låsomfånget samtidigt som du lyssnar på ljudet. (Standardvärde): RANGE 6 1. Tryck på LOCK RANGE (e). 2. Välj inställningsvärde med / (f) på fjärrkontrollen. "RANGE 6" (bred) till "RANGE 1" (smal) • Du kan också trycka på SETUP (c) för att visa LOCK RANGE ADJUST-inställningsskärmen via SETUPmenyn. • Inställningen är fixerad till "6" när man spelar MQA-CD eller en skiva med musikfiler, eller använder USB DAC. • LOCK RANGE ADJUST har ingen effekt på sacd- och DSD-ljudet. • När man skiftar inställningen under avspelning kan det hända att audio avbryts. a e b f c d g Sv 15 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Avancerade inställningar Avancerade inställningar 1 AUTO STANDBY LOADING MODE Denna inställning sätter automatiskt enheten i standby-läge efter 20 minuters inaktivitet utan någon ljudinmatning. "ON" (Standardvärde): Enheten går automatiskt in i standbyläge. "OFF": Enheten går inte automatiskt in i standbyläge. Laddningstiden för cd kan förkortas. • Aktivering av denna funktion tillåter att laddningstiden förkortas beroende på cd: n, men ljudet kan emellertid hoppa i början av avspelningen. “NORMAL” (Standardvärde): När laddningstiden för cd inte är förkortad “FAST”: När laddningstiden för cd är förkortad POWER ON PLAY Enheten gör det möjligt för dig att konfigurera avancerade inställningar för att ge dig en ännu bättre erfarenhet. 1. Tryck på SETUP på fjärrkontrollen. AUTO STANDBY 2. Välj innehållet eller inställningen med markörerna på fjärrkontrollen och tryck på ENTER för att bekräfta ditt val. Återgå till föregående skärmbild genom att trycka på RETURN. Du kan ställa in den så att skivan automatiskt börjar spela upp när den här apparaten sätts på. • Genom att använda en externt ansluten auto-timer, kan du använda timeruppspelning när strömmen sätts på automatiskt. "ON": Att spela upp skivor automatiskt "OFF" (Standardvärde): När skivor inte ska spelas upp DIGITAL OUT Gör inställningarna för digital ljudutmatning. När du inte ansluter till DIGITAL OUT OPTICAL/COAXIAL-uttaget, kan du lyssna på ännu klarare ljud genom att ställa in det på OFF. "ON" (Standardvärde), "OFF" DIGITAL FILTER Du kan välja typ av DIGITAL FILTER. (P15) UP SAMPLING Att utöka samplingsfrekvensen gör att det blir lättare att återge ljud med högre klarhet. (P15) 3. Tryck på SETUP, för att lämna inställningarna. LOCK RANGE ADJUST Justera låsomfånget. (P15) 16 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Felsökning Övrigt Innan du startar proceduren När en funktion är instabil, kan problemet lösas genom att helt enkelt sätta på strömmen, sätta den i standby eller dra ur/sätta i nätkabeln, hellre än att gå igenom inställningarna och funktionerna. Testa de enkla åtgärderna på både enheten och den anslutna utrustningen. Om problemet inte avhjälps efter att ha gått igenom "Felsökning", kan en återställning av apparaten, till samma status som vid leveransen, lösa problemet. Återställ den här apparaten (detta återställer apparatens inställningar till standardinställningarna) 1. När strömmen är på och det inte sitter någon skiva i, trycker du på DIRECT medan du trycker på och håller kvar g på huvudapparaten. 2. ”CLEAR” visas, apparaten går över i standby och inställningarna återställs. detta inte löser problemet kan det ha uppstått ett funktionsfel. Dra ur nätkabeln ur vägguttaget och kontakta återförsäljaren eller vår kundsupport. ■ Displayen tänds inte • Det är möjligt att displayen har stängts av genom att man tryckt på DISPLAY OFF. Tryck på DISPLAY OFF för att sätta på displayen. ■ Det går inte att spela skivor • Lägg i skivan i facket med etiketten uppåt. • Det kanske inte går att spela skivan om den är repig eller smutsig. • Ljudfiler som skyddas av upphovsrätt kan inte spelas upp. • Skivfacket öppnas om du sätter i en skiva som inte stöds av den här apparaten. CLEAR ■ Ström Kan inte slå på enheten • Dra ut nätkabeln ur vägguttaget, vänta minst 2 minuter och sätt sedan i den igen. Enheten stängs av oväntat • Apparaten går automatiskt i standby när inställningen är "AUTO STANDBY"-inställningen i SETUP-menyn är aktiv. STANDBY-indikatorn på huvudapparaten fortsätter att blinka rött och det går inte att använda den • Dra ut nätkabeln ur vägguttaget, vänta minst 2 minuter och sätt sedan i den igen. Indikatorn kommer att fortsätta att blinka, men tryck på 8 STANDBY/ON på huvudapparaten för att strömmen ska stå på ON. Om ■ Audio Ljudet avbryts • Om man begränsar låsomfånget för mycket med LOCK RANGE ADJUST-inställningen, kan det orsaka avbrott i ljudet och även orsaka brus. Avbrott i ljudet som orsakas av justeringen av låsomfånget täcks inte av vår funktionsgaranti. Lyssna på ljudet medan du justerar låsomfånget. Det hörs inget digitalt ljud • Ställ in "DIGITAL OUT" i SETUP-menyn på "ON". • Audio från sacd och DSD eller input från USB DAC matas inte ut digitalt. ■ Fjärrkontroll • Se till att batterierna sitter åt rätt håll. • Sätt i nya batterier. Blanda inte olika typer av batterier, eller gamla och nya batterier. • Se till att den här apparaten inte utsätts för direkt solljus eller lysrörsljus av invertertyp. Flytta vid behov. • Om den här apparaten installeras på en hylla eller i ett skåp med färgade glasdörrar eller om dörrarna är stängda kanske fjärrkontrollen inte fungerar korrekt. ■ Funktioner för D/A-omvandlare • Se till att enheterna är korrekt anslutna. • Spela upp ljud som är kompatibelt med ingångarna på den här apparaten. (P14) Kan inte spela upp ljud från datorer • Avbryt ljudavstängningen på din dator. • Välj den här apparaten i ljudutgångsinställningarna på din dator. Om källan för denna enhet är ställd till något annat än “USB DAC”, så kan datorn inte detektera denna enhet. • Om det är flera program i gång på datorn, avslutar du de du inte använder. Samplingsfrekvensen är alltid densamma genom USB DAC-ingången • Beroende på datorns inställningar, konverteras de till samma samplingsfrekvens för utmatning, även om samplingsfrekvensen för de filer som spelas upp är olika. Andra datorljud än musiken hörs genom USB DACingången • Beroende på datorns inställningar kan ljud som datorns startljud eller ljud vid felmeddelanden spelas upp genom den här apparaten. ■ SACD • På grund av skillnaderna i inspelningsmetoderna, kan det finnas en skillnad i volymen mellan en sacd och en cd. Sv 17 > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Andra anmärkningar: ■ Skivor som kan spelas upp MQA-CD Sacd (Super Audio CD) (Endast 2-kanalsområde) CD, CD-R, CD-RW DVD-R, DVD-R (DL), DVD-RW DVD+R, DVD+R (DL), DVD+RW Försiktighetsåtgärder vid uppspelning • Det går att använda cd-skivor (cd:ar) med följande logo på etikettytan. Spela hybrid-sacd Hybrid-sacd:ar består av två lager; sacd-lagret och cdlagret. Tryck på CD/SACD för att välja det lager du vill lyssna på. Spela upp DualDisks "DualDisk" är en skiva med film och ljud som följer dvdstandarden på en sida, och ljud som kan spelas på en cdspelare på den andra. Ljudsidan, som inte är dvd-sidan, kanske inte alltid går att spela upp på grund av att skivan inte följer de fysiska specifikationerna för standard-cd:ar. Funktioner vid uppspelning Direkt sökning fungerar inte medan man spelar upp skivor med musikdata. • Observera att vissa skivor kanske inte kan spelas upp på grund av skivans egenskaper, repor, smuts eller inspelningstillståndet. Spela MQA Denna enhet inkluderar MQA-teknologi (Master Quality Authenticated), vilket tillåter avspelning av MQA audiofiler och strömmar, vilket levererar ljudet från den ursprungliga masterinspelningen. Denna enhet är en cd-spelare som kan avläsa en MQA-CD. Den inbyggda MQA-avkodaren kommer att återställa den högupplösta signalen som hörs i studion och bekräfta den med hjälp av autentiseringssignaturen. Gå till www.mqa.co.uk/customer/mqacd för mer information. ‘MQA’ eller ‘MQA.’ indikerar att produkten avkodar och spelar en MQA-ström eller -fil, samt och betecknar härkomst för att säkerställa att ljudet är identiskt med källmaterialet. ‘MQA.’ indikerar att den spelar en MQA Studio-fil, vilken antingen har godkänts i studion av artisten/producenten eller har verifierats av upphovsrättsinnehavaren. 18 Typer av skivor som inte kan spelas upp på den här apparaten Dvd video, dvd audio, cd-g, video cd, DTS-CD Anmärkningar om skivor • Var försiktig så att du inte handen kommer i vägen när du öppnar och stänger skivfacket. • Använd aldrig skivor som har en ovanlig form (som hjärtan eller oktogoner). Den här typen av skivor kan fastna och skada apparaten. • Vissa ljud-cd:ar med funktioner för kopieringsskydd, följer inte officiella cd-standarder. Dessa speciella typer av skivor kan inte spelas upp med den här apparaten. • Använd inte skivor med rester av cellofantejp, hyrskivor med etiketter som har dragits av, eller skivor med dekorativa etiketter. Den här typen av skivor kan fastna i enheten eller skada enheten. • Lämna inte en skiva med en etikett som skrivits ut på en bläckstråleskrivare i apparaten under en längre tid. Skivan kan fastna i apparaten eller skada apparaten. ■ Rengöra spelaren • Normalt torkar du av spelaren med en mjuk trasa. Om smutsen sitter hårt, kan du använda ett neutralt rengöringsmedel utspätt med 5 till 6 delar vatten på en mjuk trasa. Vrid ur den ordentligt, torka av smutsen, och torka sedan igen med en torr trasa. • Observera att om man får alkohol, thinner, bensen eller insektsmedel på spelaren kan det göra att tryck och beläggnings skalas av. Undvik också att lämna gummieller vinylprodukter i kontakt med spelaren under en längre period, eftersom det kan skada höljet. • Om du använder trasor eller liknade med kemiska impregneringsmedel ska produktens varningstext läsas noga. • När det är svårt att avlägsna damm i skivfacket, använd en bit tejp etc. för att avlägsna dammet. ■ Försiktighetsåtgärder när den här apparaten flyttas Ta bort ev. skivor och stäng skivfacket när den här apparaten ska flyttas. Tryck sedan på 8 STANDBY/ON på huvudapparaten, vänta i 10 sekunder efter att [OFF] försvunnit från displayen och dra sedan ut nätkabeln. Om man flyttar apparaten medan det fortfarande sitter en skiva i, kan det orsaka skador. ■ Kondensering Det kan bildas vattendroppar inuti den här apparaten om den flyttas från en kall plats till ett varmt rum eller när ett kallt rum värms upp snabbt med värmeelement. Det kallas kondensering. Det kan inte bara orsaka att apparaten krånglar, utan det kan även skada skivan eller delar av apparaten. Vi rekommenderar att du tar bort skivor från apparaten om den inte ska användas på ett tag. Om det finns en risk för att det bildats kondens, drar du ur nätkabeln och låter apparaten stå i minst 3 timmar i rumstemperatur. > Innan du börjar > Delarnas namn > Installera > Uppspelning Avancerade inställningar | Övrigt Allmänna specifikationer ■ Analog ljudutmatning ■ Övrigt Nominell utnivå och impedans • RCA OUT : 2,3 Vrms (1 kHz, 0 dB) / 100  Styrning in • Ø3,5 miniuttag (mono) Frekvensgång • CD: 2 Hz - 20 kHz, SACD: 2 Hz - 50 kHz (-3 dB) Styruttag • Ø3,5 miniuttag (mono) Signal-/brusforhallande • CD: 116 dB eller mer (A-vägning), SACD: 116 dB eller mer (A-vägning) ■ Allmänt THD+N • CD: 0,002 % eller mindre, SACD: 0,002 % eller mindre ■ Digital Audio-ingång USB DAC • Typ B, USB Ljudklass 1.0 ■ Digital ljudutmatning Koaxial digitalutgång • RCA-uttag, 0,5 Vp-p / 75  Strömförsörjning • 220 - 230 V AC, 50/60 Hz Strömförbrukning • 43 W • 0,3 W (I standby) AUTO STANDBY • ON (20 min) / OFF Mått (B  H  D) • 435 mm  138 mm  413 mm Vikt • 13,1 kg Optisk digitalutgång • Optiskt uttag, -14 - -21 dBm / 660 nm Sv 19 License and Trademark Information Licence et marque commerciale Licencias y marcas comerciales Licenza e dei marchi Lizenz- und Warenzeichen Licentie en handelsmerken Licens och varumärke MQA and the Sound Wave Device are registered trade marks of MQA Limited. © 2016 "Super Audio CD" is a registered trademark. DSD and the Direct Stream Digital logo are trademarks of Sony Corporation. Windows 10, Windows Media, and the Windows logo are trademarks or registered trademarks of Microsoft Corporation in the United States and/or other countries. macOS is a trademark of Apple Inc., registered in the U.S. and other countries. All other trademarks are the property of their respective owners. / Toutes les autres marques commerciales sont la propriété de leurs détenteurs respectifs. / El resto de marcas comerciales son propiedad de sus respectivos propietarios. / Tutti gli altri marchi di fabbrica sono di proprietà dei rispettivi proprietari. / Alle anderen Warenzeichen sind das Eigentum ihrer jeweiligen Eigentümer. / Alle andere handelsmerken zijn eigendom van de desbetreffende rechthebbenden. / Alla andra varumärken tillhör deras respektive ägare. Important Notice Regarding Software The software package installed in this product includes software licensed to Onkyo & Pioneer Corporation (hereinafter, called "O&P Corporation") directly or indirectly by third party developers. Please be sure to read this notice regarding such software. ソフトウェアに関する重要なお知らせ本製品に搭載されるソフトウェアには、オンキヨー & パイオニア株式会社 ( 以下「弊社」とします ) が第三者より直接的に又は間接的に使用の許諾を受けたソフトウェアが含まれております。これらのソフトウェアに関する本お知らせを必ずご一読くださいますようお願い申し上げます。 Notice Regarding GNU GPL/LGPL-applicable Software This product includes the following software that is covered by GNU General Public License (hereinafter, called "GPL") or by GNU Lesser General Public License (hereinafter, called "LGPL"). O&P Corporation notifies you that, according to the attached GPL/LGPL, you have right to obtain, modify, and redistribute software source code for the listed software. GNU GPL / LGPL 適用ソフトウェアに関するお知らせ本製品には、以下の GNU General Public License( 以下「GPL」とします ) または GNU Lesser General Public License( 以下「LGPL」とします ) の適用を受けるソフトウェアが含まれております。お客様は添付の GPL/ LGPL に従いこれらのソフトウェアソースコードの入手、改変、再配布の権利があることをお知らせいたします。 Package List / パッケージリスト bash-3.2.57 gawk-3.1.5 libmtp-1.1.6 module-init-tools-3.12 psmisc-22.13 u-boot-Aug-09 coreutils-6.9 gdb-6.6 libusb-1.0.9 mtd-utils-1 squashfs-4.2 util-linux-ng-2.18 e2fsprogs-1.41.14-482 glibc-2.18 libusb-compat-0.1.4 ntfsprogs-2.0.0-482 sysvinit-2.88 zlib-1.2.3 findutils-4.2.31 gzip-1.3.12 Linux kernel-3.10.26 procps-3.2.8 tar-1.17 GNU LESSER GENERAL PUBLIC LICENSE Version 2.1, February 1999 Copyright (C) 1991, 1999 Free Software Foundation, Inc. 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. [This is the first released version of the Lesser GPL. It also counts as the successor of the GNU Library Public License, version 2, hence the version number 2.1.] Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public Licenses are intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This license, the Lesser General Public License, applies to some specially designated software packages--typically libraries--of the Free Software Foundation and other authors who decide to use it. You can use it too, but we suggest you first think carefully about whether this license or the ordinary General Public License is the better strategy to use in any particular case, based on the explanations below. When we speak of free software, we are referring to freedom of use, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish); that you receive source code or can get it if you want it; that you can change the software and use pieces of it in new free programs; and that you are informed that you can do these things. To protect your rights, we need to make restrictions that forbid distributors to deny you these rights or to ask you to surrender these rights. These restrictions translate to certain responsibilities for you if you distribute copies of the library or if you modify it. For example, if you distribute copies of the library, whether gratis or for a fee, you must give the recipients all the rights that we gave you. You must make sure that they, too, receive or can get the source code. If you link other code with the library, you must provide complete object files to the recipients, so that they can relink them with the library after making changes to the library and recompiling it. And you must show them these terms so they know their rights. We protect your rights with a two-step method: (1) we copyright the library, and (2) we offer you this license, which gives you legal permission to copy, distribute and/or modify the library. To protect each distributor, we want to make it very clear that there is no warranty for the free library. Also, if the library is modified by someone else and passed on, the recipients should know that what they have is not the original version, so that the original author's reputation will not be affected by problems that might be introduced by others. Finally, software patents pose a constant threat to the existence of any free program. We wish to make sure that a company cannot effectively restrict the users of a free program by obtaining a restrictive license from a patent holder. Therefore, we insist that any patent license obtained for a version of the library must be consistent with the full freedom of use specified in this license. Most GNU software, including some libraries, is covered by the ordinary GNU General Public License. This license, the GNU Lesser General Public License, applies to certain designated libraries, and is quite different from the ordinary General Public License. We use this license for certain libraries in order to permit linking those libraries into non-free programs. When a program is linked with a library, whether statically or using a shared library, the combination of the two is legally speaking a combined work, a derivative of the original library. The ordinary General Public License therefore permits such linking only if the entire combination fits its criteria of freedom. The Lesser General Public License permits more lax criteria for linking other code with the library. We call this license the "Lesser" General Public License because it does Less to protect the user's freedom than the ordinary General Public License. It also provides other free software developers Less of an advantage over competing non-free programs. These disadvantages are the reason we use the ordinary General Public License for many libraries. However, the Lesser license provides advantages in certain special circumstances. For example, on rare occasions, there may be a special need to encourage the widest possible use of a certain library, so that it becomes a de-facto standard. To achieve this, nonfree programs must be allowed to use the library. A more frequent case is that a free library does the same job as widely used non-free libraries. In this case, there is little to gain by limiting the free library to free software only, so we use the Lesser General Public License. In other cases, permission to use a particular library in non-free programs enables a greater number of people to use a large body of free software. For example, permission to use the GNU C Library in non-free programs enables many more people to use the whole GNU operating system, as well as its variant, the GNU/Linux operating system. Although the Lesser General Public License is Less protective of the users' freedom, it does ensure that the user of a program that is linked with the Library has the freedom and the wherewithal to run that program using a modified version of the Library. The precise terms and conditions for copying, distribution and modification follow. Pay close attention to the difference between a "work based on the library" and a "work that uses the library". The former contains code derived from the library, whereas the latter must be combined with the library in order to run. TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License Agreement applies to any software library or other program which contains a notice placed by the copyright holder or other authorized party saying it may be distributed under the terms of this Lesser General Public License (also called "this License"). Each licensee is addressed as "you". A "library" means a collection of software functions and/or data prepared so as to be conveniently linked with application programs (which use some of those functions and data) to form executables. The "Library", below, refers to any such software library or work which has been distributed under these terms. A "work based on the Library" means either the Library or any derivative work under copyright law: that is to say, a work containing the Library or a portion of it, either verbatim or with modifications and/or translated straightforwardly into another language. (Hereinafter, translation is included without limitation in the term "modification".) "Source code" for a work means the preferred form of the work for making modifications to it. For a library, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the library. Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running a program using the Library is not restricted, and output from such a program is covered 20 only if its contents constitute a work based on the Library (independent of the use of the Library in a tool for writing it). Whether that is true depends on what the Library does and what the program that uses the Library does. 1. You may copy and distribute verbatim copies of the Library's complete source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and distribute a copy of this License along with the Library. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Library or any portion of it, thus forming a work based on the Library, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) The modified work must itself be a software library. b) You must cause the files modified to carry prominent notices stating that you changed the files and the date of any change. c) You must cause the whole of the work to be licensed at no charge to all third parties under the terms of this License d) If a facility in the modified Library refers to a function or a table of data to be supplied by an application program that uses the facility, other than as an argument passed when the facility is invoked, then you must make a good faith effort to ensure that, in the event an application does not supply such function or table, the facility still operates, and performs whatever part of its purpose remains meaningful. (For example, a function in a library to compute square roots has a purpose that is entirely well-defined independent of the application. Therefore, Subsection 2d requires that any application-supplied function or table used by this function must be optional: if the application does not supply it, the square root function must still compute square roots.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Library, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Library, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Library. In addition, mere aggregation of another work not based on the Library with the Library (or with a work based on the Library) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may opt to apply the terms of the ordinary GNU General Public License instead of this License to a given copy of the Library. To do this, you must alter all the notices that refer to this License, so that they refer to the ordinary GNU General Public License, version 2, instead of to this License. (If a newer version than version 2 of the ordinary GNU General Public License has appeared, then you can specify that version instead if you wish.) Do not make any other change in these notices. Once this change is made in a given copy, it is irreversible for that copy, so the ordinary GNU General Public License applies to all subsequent copies and derivative works made from that copy. This option is useful when you wish to copy part of the code of the Library into a program that is not a library. 4. You may copy and distribute the Library (or a portion or derivative of it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange. If distribution of object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place satisfies the requirement to distribute the source code, even though third parties are not compelled to copy the source along with the object code. 5. A program that contains no derivative of any portion of the Library, but is designed to work with the Library by being compiled or linked with it, is called a "work that uses the Library". Such a work, in isolation, is not a derivative work of the Library, and therefore falls outside the scope of this License. However, linking a "work that uses the Library" with the Library creates an executable that is a derivative of the Library (because it contains portions of the Library), rather than a "work that uses the library". The executable is therefore covered by this License. Section 6 states terms for distribution of such executables. When a "work that uses the Library" uses material from a header file that is part of the Library, the object code for the work may be a derivative work of the Library even though the source code is not. Whether this is true is especially significant if the work can be linked without the Library, or if the work is itself a library. The threshold for this to be true is not precisely defined by law. If such an object file uses only numerical parameters, data structure layouts and accessors, and small macros and small inline functions (ten lines or less in length), then the use of the object file is unrestricted, regardless of whether it is legally a derivative work. (Executables containing this object code plus portions of the Library will still fall under Section 6.) Otherwise, if the work is a derivative of the Library, you may distribute the object code for the work under the terms of Section 6. Any executables containing that work also fall under Section 6, whether or not they are linked directly with the Library itself. 6. As an exception to the Sections above, you may also combine or link a "work that uses the Library" with the Library to produce a work containing portions of the Library, and distribute that work under terms of your choice, provided that the terms permit modification of the work for the customer's own use and reverse engineering for debugging such modifications. You must give prominent notice with each copy of the work that the Library is used in it and that the Library and its use are covered by this License. You must supply a copy of this License. If the work during execution displays copyright notices, you must include the copyright notice for the Library among them, as well as a reference directing the user to the copy of this License. Also, you must do one of these things: a) Accompany the work with the complete corresponding machine-readable source code for the Library including whatever changes were used in the work (which must be distributed under Sections 1 and 2 above); and, if the work is an executable linked with the Library, with the complete machine-readable "work that uses the Library", as object code and/or source code, so that the user can modify the Library and then relink to produce a modified executable containing the modified Library. (It is understood that the user who changes the contents of definitions files in the Library will not necessarily be able to recompile the application to use the modified definitions.) b) Use a suitable shared library mechanism for linking with the Library. A suitable mechanism is one that (1) uses at run time a copy of the library already present on the user's computer system, rather than copying library functions into the executable, and (2) will operate properly with a modified version of the library, if the user installs one, as long as the modified version is interface-compatible with the version that the work was made with. c) Accompany the work with a written offer, valid for at least three years, to give the same user the materials specified in Subsection 6a, above, for a charge no more than the cost of performing this distribution. d) If distribution of the work is made by offering access to copy from a designated place, offer equivalent access to copy the above specified materials from the same place. e) Verify that the user has already received a copy of these materials or that you have already sent this user a copy. For an executable, the required form of the "work that uses the Library" must include any data and utility programs needed for reproducing the executable from it. However, as a special exception, the materials to be distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. It may happen that this requirement contradicts the license restrictions of other proprietary libraries that do not normally accompany the operating system. Such a contradiction means you cannot use both them and the Library together in an executable that you distribute. 7. You may place library facilities that are a work based on the Library side-by-side in a single library together with other library facilities not covered by this License, and distribute such a combined library, provided that the separate distribution of the work based on the Library and of the other library facilities is otherwise permitted, and provided that you do these two things: a) Accompany the combined library with a copy of the same work based on the Library, uncombined with any other library facilities. This must be distributed under the terms of the Sections above. b) Give prominent notice with the combined library of the fact that part of it is a work based on the Library, and explaining where to find the accompanying uncombined form of the same work. 8. You may not copy, modify, sublicense, link with, or distribute the Library except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense, link with, or distribute the Library is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 9. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Library or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Library (or any work based on the Library), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Library or works based on it. 10. Each time you redistribute the Library (or any work based on the Library), the recipient automatically receives a license from the original licensor to copy, distribute, link with or modify the Library subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties with this License. 11. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Library at all. For example, if a patent license would not permit royalty-free redistribution of the Library by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Library. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply, and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 12. If the distribution and/or use of the Library is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Library under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 13. The Free Software Foundation may publish revised and/or new versions of the Lesser General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Library specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Library does not specify a license version number, you may choose any version ever published by the Free Software Foundation. 14. If you wish to incorporate parts of the Library into other free programs whose distribution conditions are incompatible with these, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. ＊ NO WARRANTY 15. BECAUSE THE LIBRARY IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE LIBRARY, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE LIBRARY "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE LIBRARY IS WITH YOU. SHOULD THE LIBRARY PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 16. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE LIBRARY AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE LIBRARY (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE LIBRARY TO OPERATE WITH ANY OTHER SOFTWARE), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Libraries If you develop a new library, and you want it to be of the greatest possible use to the public, we recommend making it free software that everyone can redistribute and change. You can do so by permitting redistribution under these terms (or, alternatively, under the terms of the ordinary General Public License). To apply these terms, attach the following notices to the library. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. <one line to give the library's name and an idea of what it does.> Copyright (C) <year> <name of author> This library is free software; you can redistribute it and/or modify it under the terms of the GNU Lesser General Public License as published by the Free Software Foundation; either version 2.1 of the License, or (at your option) any later version. This library is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU Lesser General Public License for more details. You should have received a copy of the GNU Lesser General Public License along with this library; if not, write to the Free Software Foundation, Inc., 59 Temple Place, Suite 330, Boston, MA 02111-1307 USA Also add information on how to contact you by electronic and paper mail. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the library, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the library `Frob' (a library for tweaking knobs) written by James Random Hacker. signature of Ty Coon, 1 April 1990 Ty Coon, President of Vice That's all there is to it! GNU GENERAL PUBLIC LICENSE Version 2, June 1991 Copyright (C) 1989, 1991 Free Software Foundation, Inc.59 Temple Place - Suite 330, Boston, MA 02111-1307, USA Everyone is permitted to copy and distribute verbatim copies of this license document, but changing it is not allowed. Preamble The licenses for most software are designed to take away your freedom to share and change it. By contrast, the GNU General Public License is intended to guarantee your freedom to share and change free software--to make sure the software is free for all its users. This General Public License applies to most of the Free Software Foundation's software and to any other program whose authors commit to using it. (Some other Free Software Foundation software is covered by the GNU Library General Public License instead.) You can apply it to your programs, too. When we speak of free software, we are referring to freedom, not price. Our General Public Licenses are designed to make sure that you have the freedom to distribute copies of free software (and charge for this service if you wish), that you receive source code or can get it if you want it, that you can change the software or use pieces of it in new free programs; and that you know you can do these things. To protect your rights, we need to make restrictions that forbid anyone to deny you these rights or to ask you to surrender the rights. These restrictions translate to certain responsibilities for you if you distribute copies of the software, or if you modify it. For example, if you distribute copies of such a program, whether gratis or for a fee, you must give the recipients all the rights that you have. You must make sure that they, too, receive or can get the source code. And you must show them these terms so they know their rights. We protect your rights with two steps: (1) copyright the software, and (2) offer you this license which gives you legal permission to copy, distribute and/or modify the software. Also, for each author's protection and ours, we want to make certain that everyone understands that there is no warranty for this free software. If the software is modified by someone else and passed on, we want its recipients to know that what they have is not the original, so that any problems introduced by others will not reflect on the original authors' reputations. Finally, any free program is threatened constantly by software patents. We wish to avoid the danger that redistributors of a free program will individually obtain patent licenses, in effect making the program proprietary. To prevent this, we have made it clear that any patent must be licensed for everyone's free use or not licensed at all. The precise terms and conditions for copying, distribution and modification follow. TERMS AND CONDITIONS FOR COPYING, DISTRIBUTION AND MODIFICATION 0. This License applies to any program or other work which contains a notice placed by the copyright holder saying it may be distributed under the terms of this General Public License. The "Program", below, refers to any such program or work, and a "work based on the Program" means either the Program or any derivative work under copyright law: that is to say, a work containing the Program or a portion of it, either verbatim or with modifications and/or translated into another language. (Hereinafter, translation is included without limitation in the term "modification".) Each licensee is addressed as "you". Activities other than copying, distribution and modification are not covered by this License; they are outside its scope. The act of running the Program is not restricted, and the output from the Program is covered only if its contents constitute a work based on the Program (independent of having been made by running the Program). Whether that is true depends on what the Program does. 1. You may copy and distribute verbatim copies of the Program's source code as you receive it, in any medium, provided that you conspicuously and appropriately publish on each copy an appropriate copyright notice and disclaimer of warranty; keep intact all the notices that refer to this License and to the absence of any warranty; and give any other recipients of the Program a copy of this License along with the Program. You may charge a fee for the physical act of transferring a copy, and you may at your option offer warranty protection in exchange for a fee. 2. You may modify your copy or copies of the Program or any portion of it, thus forming a work based on the Program, and copy and distribute such modifications or work under the terms of Section 1 above, provided that you also meet all of these conditions: a) You must cause the modified files to carry prominent notices stating that you changed the files and the date of any change. b) You must cause any work that you distribute or publish, that in whole or in part contains or is derived from the Program or any part thereof, to be licensed as a whole at no charge to all third parties under the terms of this License. c) If the modified program normally reads commands interactively when run, you must cause it, when started running for such interactive use in the most ordinary way, to print or display an announcement including an appropriate copyright notice and a notice that there is no warranty (or else, saying that you provide a warranty) and that users may redistribute the program under these conditions, and telling the user how to view a copy of this License. (Exception: if the Program itself is interactive but does not normally print such an announcement, your work based on the Program is not required to print an announcement.) These requirements apply to the modified work as a whole. If identifiable sections of that work are not derived from the Program, and can be reasonably considered independent and separate works in themselves, then this License, and its terms, do not apply to those sections when you distribute them as separate works. But when you distribute the same sections as part of a whole which is a work based on the Program, the distribution of the whole must be on the terms of this License, whose permissions for other licensees extend to the entire whole, and thus to each and every part regardless of who wrote it. Thus, it is not the intent of this section to claim rights or contest your rights to work written entirely by you; rather, the intent is to exercise the right to control the distribution of derivative or collective works based on the Program. In addition, mere aggregation of another work not based on the Program with the Program (or with a work based on the Program) on a volume of a storage or distribution medium does not bring the other work under the scope of this License. 3. You may copy and distribute the Program (or a work based on it, under Section 2) in object code or executable form under the terms of Sections 1 and 2 above provided that you also do one of the following: a) Accompany it with the complete corresponding machine-readable source code, which must be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange;or, b) Accompany it with a written offer, valid for at least three years, to give any third party, for a charge no more than your cost of physically performing source distribution, a complete machine-readable copy of the corresponding source code, to be distributed under the terms of Sections 1 and 2 above on a medium customarily used for software interchange; or, c) Accompany it with the information you received as to the offer to distribute corresponding source code. (This alternative is allowed only for noncommercial distribution and only if you received the program in object code or executable form with such an offer, in accord with Subsection b above.) The source code for a work means the preferred form of the work for making modifications to it. For an executable work, complete source code means all the source code for all modules it contains, plus any associated interface definition files, plus the scripts used to control compilation and installation of the executable. However, as a special exception, the source code distributed need not include anything that is normally distributed (in either source or binary form) with the major components (compiler, kernel, and so on) of the operating system on which the executable runs, unless that component itself accompanies the executable. If distribution of executable or object code is made by offering access to copy from a designated place, then offering equivalent access to copy the source code from the same place counts as distribution of the source code, even though third parties are not compelled to copy the source along with the object code. 4. You may not copy, modify, sublicense, or distribute the Program except as expressly provided under this License. Any attempt otherwise to copy, modify, sublicense or distribute the Program is void, and will automatically terminate your rights under this License. However, parties who have received copies, or rights, from you under this License will not have their licenses terminated so long as such parties remain in full compliance. 5. You are not required to accept this License, since you have not signed it. However, nothing else grants you permission to modify or distribute the Program or its derivative works. These actions are prohibited by law if you do not accept this License. Therefore, by modifying or distributing the Program (or any work based on the Program), you indicate your acceptance of this License to do so, and all its terms and conditions for copying, distributing or modifying the Program or works based on it. 6. Each time you redistribute the Program (or any work based on the Program), the recipient automatically receives a license from the original licensor to copy, distribute or modify the Program subject to these terms and conditions. You may not impose any further restrictions on the recipients' exercise of the rights granted herein. You are not responsible for enforcing compliance by third parties to this License. 7. If, as a consequence of a court judgment or allegation of patent infringement or for any other reason (not limited to patent issues), conditions are imposed on you (whether by court order, agreement or otherwise) that contradict the conditions of this License, they do not excuse you from the conditions of this License. If you cannot distribute so as to satisfy simultaneously your obligations under this License and any other pertinent obligations, then as a consequence you may not distribute the Program at all. For example, if a patent license would not permit royaltyfree redistribution of the Program by all those who receive copies directly or indirectly through you, then the only way you could satisfy both it and this License would be to refrain entirely from distribution of the Program. If any portion of this section is held invalid or unenforceable under any particular circumstance, the balance of the section is intended to apply and the section as a whole is intended to apply in other circumstances. It is not the purpose of this section to induce you to infringe any patents or other property right claims or to contest validity of any such claims; this section has the sole purpose of protecting the integrity of the free software distribution system, which is implemented by public license practices. Many people have made generous contributions to the wide range of software distributed through that system in reliance on consistent application of that system; it is up to the author/donor to decide if he or she is willing to distribute software through any other system and a licensee cannot impose that choice. This section is intended to make thoroughly clear what is believed to be a consequence of the rest of this License. 8. If the distribution and/or use of the Program is restricted in certain countries either by patents or by copyrighted interfaces, the original copyright holder who places the Program under this License may add an explicit geographical distribution limitation excluding those countries, so that distribution is permitted only in or among countries not thus excluded. In such case, this License incorporates the limitation as if written in the body of this License. 9. The Free Software Foundation may publish revised and/or new versions of the General Public License from time to time. Such new versions will be similar in spirit to the present version, but may differ in detail to address new problems or concerns. Each version is given a distinguishing version number. If the Program specifies a version number of this License which applies to it and "any later version", you have the option of following the terms and conditions either of that version or of any later version published by the Free Software Foundation. If the Program does not specify a version number of this License, you may choose any version ever published by the Free Software Foundation. 10. If you wish to incorporate parts of the Program into other free programs whose distribution conditions are different, write to the author to ask for permission. For software which is copyrighted by the Free Software Foundation, write to the Free Software Foundation; we sometimes make exceptions for this. Our decision will be guided by the two goals of preserving the free status of all derivatives of our free software and of promoting the sharing and reuse of software generally. NO WARRANTY 11. BECAUSE THE PROGRAM IS LICENSED FREE OF CHARGE, THERE IS NO WARRANTY FOR THE PROGRAM, TO THE EXTENT PERMITTED BY APPLICABLE LAW. EXCEPT WHEN OTHERWISE STATED IN WRITING THE COPYRIGHT HOLDERS AND/OR OTHER PARTIES PROVIDE THE PROGRAM "AS IS" WITHOUT WARRANTY OF ANY KIND, EITHER EXPRESSED OR IMPLIED, INCLUDING, BUT NOT LIMITED TO, THE IMPLIED WARRANTIES OF MERCHANTABILITY AND FITNESS FOR A PARTICULAR PURPOSE. THE ENTIRE RISK AS TO THE QUALITY AND PERFORMANCE OF THE PROGRAM IS WITH YOU. SHOULD THE PROGRAM PROVE DEFECTIVE, YOU ASSUME THE COST OF ALL NECESSARY SERVICING, REPAIR OR CORRECTION. 12. IN NO EVENT UNLESS REQUIRED BY APPLICABLE LAW OR AGREED TO IN WRITING WILL ANY COPYRIGHT HOLDER, OR ANY OTHER PARTY WHO MAY MODIFY AND/OR REDISTRIBUTE THE PROGRAM AS PERMITTED ABOVE, BE LIABLE TO YOU FOR DAMAGES, INCLUDING ANY GENERAL, SPECIAL, INCIDENTAL OR CONSEQUENTIAL DAMAGES ARISING OUT OF THE USE OR INABILITY TO USE THE PROGRAM (INCLUDING BUT NOT LIMITED TO LOSS OF DATA OR DATA BEING RENDERED INACCURATE OR LOSSES SUSTAINED BY YOU OR THIRD PARTIES OR A FAILURE OF THE PROGRAM TO OPERATE WITH ANY OTHER PROGRAMS), EVEN IF SUCH HOLDER OR OTHER PARTY HAS BEEN ADVISED OF THE POSSIBILITY OF SUCH DAMAGES. END OF TERMS AND CONDITIONS How to Apply These Terms to Your New Programs If you develop a new program, and you want it to be of the greatest possible use to the public, the best way to achieve this is to make it free software which everyone can redistribute and change under these terms. To do so, attach the following notices to the program. It is safest to attach them to the start of each source file to most effectively convey the exclusion of warranty; and each file should have at least the "copyright" line and a pointer to where the full notice is found. <one line to give the program's name and an idea of what it does.> Copyright (C) <year> <name of author> This program is free software; you can redistribute it and/or modify it under the terms of the GNU General Public License as published by the Free Software Foundation; either version 2 of the License, or (at your option) any later version. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. You should have received a copy of the GNU General Public License along with this program; if not, write to the Free Software Foundation, Inc., 59 Temple Place - Suite 330, Boston, MA 02111-1307, USA. Also add information on how to contact you by electronic and paper mail. If the program is interactive, make it output a short notice like this when it starts in an interactive mode: Gnomovision version 69, Copyright (C) year name of author Gnomovision comes with ABSOLUTELY NO WARRANTY; for details type `show w'. This is free software, and you are welcome to redistribute it under certain conditions; type `show c' for details. The hypothetical commands `show w' and `show c' should show the appropriate parts of the General Public License. Of course, the commands you use may be called something other than `show w' and `show c'; they could even be mouse-clicks or menu items--whatever suits your program. You should also get your employer (if you work as a programmer) or your school, if any, to sign a "copyright disclaimer" for the program, if necessary. Here is a sample; alter the names: Yoyodyne, Inc., hereby disclaims all copyright interest in the program `Gnomovision' (which makes passes at compilers) written by James Hacker. <signature of Ty Coon>, 1 April 1989 Ty Coon, President of Vice This General Public License does not permit incorporating your program into proprietary programs. If your program is a subroutine library, you may consider it more useful to permit linking proprietary applications with the library. If this is what you want to do, use the GNU Library General Public License instead of this License. Notice Regarding Third-party Software / その他第三者ソフトウェアに関するお知らせ This product includes the following software that is directly or indirectly licensed to O&P Corporation by third-party developers. Please refer to the PDF files on the following website about the notice in response to requests from the copyright owners of each piece of software. https://www.onkyo.com/manual/oss/2017pd.pdf 本製品には弊社が第三者より直接的に又は間接的に使用の許諾を受けた下記ソフトウェアが含まれております。各ソフトウェアの著作権者の要求に基づく通知については、以下のサイトより PDF ファイルをご参照ください。 https://www.onkyo.com/manual/oss/2017pd.pdf You may obtain a complete machine-readable copy of the corresponding source code on a physical medium by contacting Customer Service. This offer is valid to any third party within three years after last shipment of the product. Costs of physical distribution will be charged. コールセンターにお問い合わせいただければ、対応するソースコードの完全な機械可読コピーを物理メディアでお渡しします。製品の最終出荷後、3 年間有効です。掛かる費用についてはご負担いただきます。 21 22 23 1-10-5 Yokoami, Sumida-ku, Tokyo 130-0015 JAPAN <U.S.A.> 18 PARK WAY, UPPER SADDLE RIVER, NEW JERSEY 07458, U.S.A. Tel: 1-201-785-2600 Tel: 1-844-679-5350 <Germany> Gutenbergstrasse 3, 82178 Puchheim, Germany Tel: +49 (0)89 2170 497 97 (For Product Support only) https://www.pioneer-audiovisual.eu/de <UK> Meridien House, Ground Floor, 69-71 Clarendon Road, Watford, Hertfordshire WD17 1DS, United Kingdom Tel: +44 (0)20 3936 8086 (For Product Support only) https://www.pioneer-audiovisual.eu/uk <France> 6, Avenue de Marais F - 95816 Argenteuil Cedex France Tel: +33 (0)1 82 88 15 06 (For Product Support only) https://www.pioneer-audiovisual.eu/fr EU Official Web Site https://www.pioneer-audiovisual.eu/eu Register your product on / Enregistrez votre produit sur / Registre su producto en http://www.pioneerelectronics.com (US) http://www.pioneerelectronics.ca (Canada) © 2019 Onkyo & Pioneer Corporation. All rights reserved. © 2019 Onkyo & Pioneer Corporation. Tous droits de reproduction et de traduction réservés. H1909-0 “Pioneer” is a trademark of Pioneer Corporation, and is used under license. Printed in Malaysia / Imprimé en Malaisie SN 29403686 * 2 9 4 0 3 6 8 6 *